F267856

General Info

Members Datasets Scaffolds Average Seq Length
176 109 352 249

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100177452|Ga0070706_1001774522
Length 271
Sequence MGQCNASESKRTGRNWEKRSDRNPALLQLVTIDLYLMTVETDRDRLTVEELASRFRAEMIPLSKTFSYFCVMPVAEEDLKQYLHEPISALPPAACECLPKIGIFLVPFLEKQNGKGGDSVTFEKPSDNRQIVASRTFADNASTLVFAIKDEEVSDYHYCFYNAVAGLLAQSCPTDAQDSFFRVLREELNSEVHGEVDERSWRMKQALLRYALQSLEDTLTLYLHGICCDIDVETGPRQMPSRYLRKRLEALSALFPPPEGYAVFPEQSSKR

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
68 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
69 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
70 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
98 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
109 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.16
Stem 0
Stem Tuber 0
Unclassified 28.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100177452 3300005467 Bacteria 1989
2 Ga0070658_10011713 3300005327 Bacteria 7035
3 Ga0070683_100000008 3300005329 Bacteria 329206
4 Ga0070683_100052203 3300005329 Bacteria 3787
5 Ga0070683_100258011 3300005329 Bacteria 1658
6 Ga0070683_100493150 3300005329 Unclassified 1170
7 Ga0070674_100068718 3300005356 Bacteria 2497
8 Ga0070673_100016896 3300005364 Bacteria 5174
9 Ga0070673_100148200 3300005364 Unclassified 1985
10 Ga0070709_10040308 3300005434 Bacteria 2871
11 Ga0070713_100071824 3300005436 Bacteria 2926
12 Ga0070708_100157102 3300005445 Bacteria 2118
13 Ga0070681_10022458 3300005458 Bacteria 6335
14 Ga0070681_10047536 3300005458 Bacteria 4290
15 Ga0070706_100390530 3300005467 Unclassified 1295
16 Ga0070699_100160598 3300005518 Bacteria 1989
17 Ga0070679_100007653 3300005530 Bacteria 10113
18 Ga0070679_100554364 3300005530 Unclassified 1093
19 Ga0070684_100000002 3300005535 Bacteria 257669
20 Ga0070684_100130607 3300005535 Bacteria 2266
21 Ga0070697_100088600 3300005536 Bacteria 2556
22 Ga0068855_100015495 3300005563 Bacteria 9179
23 Ga0068856_100021409 3300005614 Bacteria 6286
24 Ga0068852_100075616 3300005616 Bacteria 2971
25 Ga0068859_100069572 3300005617 Bacteria 3555
26 Ga0068859_100290105 3300005617 Bacteria 1729
27 Ga0068860_100746092 3300005843 Unclassified 990
28 Ga0070717_10167004 3300006028 Bacteria 1912
29 Ga0070717_10512953 3300006028 Unclassified 1084
30 Ga0068871_100081838 3300006358 Unclassified 2676
31 Ga0075431_100008001 3300006847 Bacteria 10546
32 Ga0097620_100069573 3300006931 Bacteria 3555
33 Ga0097620_100290094 3300006931 Bacteria 1729
34 Ga0105240_10001086 3300009093 Bacteria 48011
35 Ga0105240_10200672 3300009093 Bacteria 2337
36 Ga0105240_10233607 3300009093 Unclassified 2135
37 Ga0105240_10285054 3300009093 Unclassified 1896
38 Ga0105240_10678234 3300009093 Unclassified 1127
39 Ga0105242_10355993 3300009176 Unclassified 1353
40 Ga0105242_10508801 3300009176 Bacteria 1147
41 Ga0105248_10067172 3300009177 Bacteria 4025
42 Ga0105248_10686823 3300009177 Bacteria 1155
43 Ga0105248_11379759 3300009177 Unclassified 797
44 Ga0105237_10125690 3300009545 Unclassified 2559
45 Ga0105237_10822904 3300009545 Unclassified 935
46 Ga0105238_10222535 3300009551 Bacteria 1864
47 Ga0105239_10144121 3300010375 Bacteria 2656
48 Ga0157370_10572314 3300013104 Bacteria 1035
49 Ga0157369_10021450 3300013105 Bacteria 7226
50 Ga0157369_10038998 3300013105 Bacteria 5193
51 Ga0157369_10114069 3300013105 Unclassified 2870
52 Ga0157374_10211988 3300013296 Bacteria 1899
53 Ga0157374_10418322 3300013296 Bacteria 1339
54 Ga0157378_10922581 3300013297 Unclassified 905
55 Ga0163162_10410173 3300013306 Unclassified 1487
56 Ga0157372_10034142 3300013307 Bacteria 5591
57 Ga0157372_10130539 3300013307 Bacteria 2891
58 Ga0157372_10464149 3300013307 Unclassified 1476
59 Ga0157375_10164928 3300013308 Bacteria 2360
60 Ga0157375_10221434 3300013308 Unclassified 2051
61 Ga0163163_10186334 3300014325 Unclassified 2123
62 Ga0157376_10151346 3300014969 Unclassified 2093
63 Ga0157376_10361490 3300014969 Bacteria 1392
64 Ga0213875_10074642 3300021388 Unclassified 1582
65 Ga0207699_10151805 3300025906 Unclassified 1533
66 Ga0207705_10011709 3300025909 Bacteria 6336
67 Ga0207684_10126388 3300025910 Bacteria 2194
68 Ga0207684_10159698 3300025910 Bacteria 1941
69 Ga0207707_10013330 3300025912 Bacteria 7165
70 Ga0207707_10121504 3300025912 Bacteria 2284
71 Ga0207695_10005447 3300025913 Bacteria 16868
72 Ga0207695_10305045 3300025913 Unclassified 1483
73 Ga0207671_10072243 3300025914 Unclassified 2575
74 Ga0207693_10253203 3300025915 Bacteria 1382
75 Ga0207663_10050877 3300025916 Bacteria 2577
76 Ga0207663_10374172 3300025916 Bacteria 1084
77 Ga0207652_10041265 3300025921 Unclassified 3922
78 Ga0207694_10242373 3300025924 Bacteria 1473
79 Ga0207650_10159587 3300025925 Unclassified 1786
80 Ga0207670_10412047 3300025936 Unclassified 1082
81 Ga0207669_10114768 3300025937 Bacteria 1814
82 Ga0207711_10047751 3300025941 Bacteria 3662
83 Ga0207661_10000008 3300025944 Bacteria 451211
84 Ga0207661_10294233 3300025944 Unclassified 1454
85 Ga0207661_10300377 3300025944 Bacteria 1439
86 Ga0207667_10145718 3300025949 Bacteria 2438
87 Ga0207651_10012760 3300025960 Bacteria 4773
88 Ga0207702_10111957 3300026078 Bacteria 2429
89 Ga0207641_10188256 3300026088 Unclassified 1895
90 Ga0207648_10407603 3300026089 Bacteria 1233
91 Ga0207698_10691921 3300026142 Bacteria 1014
92 Ga0268266_10451076 3300028379 Unclassified 1223
93 Ga0268264_10643174 3300028381 Bacteria 1049
94 Ga0265338_10075451 3300028800 Unclassified 2861
95 Ga0265762_1006136 3300030760 Bacteria 2153
96 Ga0265331_10014832 3300031250 Bacteria 4135
97 Ga0265331_10059901 3300031250 Unclassified 1799
98 Ga0265316_10001959 3300031344 Bacteria 21637
99 Ga0265316_10060891 3300031344 Bacteria 2933
100 Ga0265316_10099450 3300031344 Bacteria 2212
101 Ga0265316_10200385 3300031344 Bacteria 1480
102 Ga0265316_10315463 3300031344 Bacteria 1136
103 Ga0265314_10141501 3300031711 Bacteria 1486
104 Ga0265342_10045336 3300031712 Bacteria 2647
105 Ga0373926_0006029 3300035083 Unclassified 4011
106 Ga0373926_0065434 3300035083 Bacteria 1330
107 Ga0373931_0288293 3300035691 Unclassified 1010
108 Ga0373927_0000140 3300035695 Bacteria 56241
109 Ga0373927_0002929 3300035695 Bacteria 12403
110 Ga0373927_0443757 3300035695 Unclassified 857
111 Ga0373947_0003269 3300035725 Bacteria 9608
112 Ga0373937_0247505 3300036401 Unclassified 1680
113 Ga0373937_0285913 3300036401 Unclassified 1558
114 Ga0373937_0348698 3300036401 Bacteria 1402
115 Ga0373925_0000288 3300037068 Bacteria 52560
116 Ga0373925_0106611 3300037068 Unclassified 2160
117 Ga0436364_0112142 3300037853 Unclassified 2243
118 Ga0436364_0328380 3300037853 Unclassified 2108
119 Ga0436364_1513780 3300037853 Unclassified 1013
120 Ga0436365_0855703 3300039437 Bacteria 3999
121 Ga0466963_0431953 3300044694 Unclassified 929
122 Ga0451576_0065787 3300045051 Bacteria 3774
123 Ga0495592_0098451 3300046454 Bacteria 2087
124 Ga0495653_0033531 3300046463 Bacteria 4067
125 Ga0495580_0012519 3300046472 Bacteria 6503
126 Ga0495580_0140877 3300046472 Bacteria 1671
127 Ga0495580_0224205 3300046472 Bacteria 1291
128 Ga0495580_0314828 3300046472 Unclassified 1064
129 Ga0495582_0277186 3300046473 Unclassified 963
130 Ga0495639_0291275 3300046475 Bacteria 813
131 Ga0495662_0012618 3300046476 Bacteria 4121
132 Ga0495664_0098449 3300046477 Bacteria 1761
133 Ga0495664_0332594 3300046477 Bacteria 916
134 Ga0495594_0191582 3300046499 Unclassified 1165
135 Ga0495618_0022251 3300046514 Bacteria 3915
136 Ga0495628_0051561 3300046516 Bacteria 3253
137 Ga0495628_0202042 3300046516 Bacteria 1497
138 Ga0495630_0055058 3300046517 Bacteria 2980
139 Ga0495652_0062519 3300046529 Bacteria 3139
140 Ga0495665_0211630 3300046531 Unclassified 1004
141 Ga0495640_0058434 3300046533 Bacteria 2630
142 Ga0495640_0107179 3300046533 Bacteria 1829
143 Ga0495587_0274743 3300046536 Bacteria 945
144 Ga0495645_0056321 3300046543 Bacteria 2854
145 Ga0495645_0108888 3300046543 Bacteria 1962
146 Ga0495645_0201211 3300046543 Bacteria 1351
147 Ga0495667_0001779 3300046559 Bacteria 14293
148 Ga0495667_0028359 3300046559 Bacteria 3770
149 Ga0495667_0363593 3300046559 Bacteria 913
150 Ga0495634_0017187 3300046642 Bacteria 5166
151 Ga0495657_0277195 3300046675 Bacteria 1004
152 Ga0495599_0001924 3300046678 Bacteria 12019
153 Ga0495599_0305952 3300046678 Bacteria 959
154 Ga0495623_0005479 3300046679 Bacteria 8296
155 Ga0495613_0058415 3300046689 Bacteria 2831
156 Ga0495613_0402424 3300046689 Bacteria 934
157 Ga0495600_0049037 3300046809 Bacteria 2755
158 Ga0495604_0024530 3300047317 Bacteria 4811
159 Ga0495604_0054221 3300047317 Unclassified 3095
160 Ga0495604_0093490 3300047317 Bacteria 2225
161 Ga0495604_0170379 3300047317 Bacteria 1531
162 Ga0495604_0447502 3300047317 Unclassified 844
163 Ga0495674_0003052 3300047319 Bacteria 16285
164 Ga0495674_0039865 3300047319 Bacteria 4205
165 Ga0495680_0083027 3300047322 Bacteria 2417
166 Ga0495675_0098274 3300047444 Unclassified 1834
167 Ga0495675_0168575 3300047444 Bacteria 1345
168 Ga0495684_0035240 3300047471 Bacteria 3838
169 Ga0495684_0054493 3300047471 Bacteria 3050
170 Ga0495684_0153235 3300047471 Bacteria 1722
171 Ga0495602_0003952 3300048088 Bacteria 15448
172 Ga0495602_0231037 3300048088 Unclassified 1390
173 Ga0501048_0210563 3300049582 Bacteria 1379
174 Ga0495619_0513053 3300053085 Bacteria 824
175 Ga0501082_0000532 3300060353 Bacteria 33889
176 Ga0501082_0743876 3300060353 Bacteria 858
177 Ga0070706_100177452
178 Ga0070658_10011713
179 Ga0070683_100000008
180 Ga0070683_100052203
181 Ga0070683_100258011
182 Ga0070683_100493150
183 Ga0070674_100068718
184 Ga0070673_100016896
185 Ga0070673_100148200
186 Ga0070709_10040308
187 Ga0070713_100071824
188 Ga0070708_100157102
189 Ga0070681_10022458
190 Ga0070681_10047536
191 Ga0070706_100390530
192 Ga0070699_100160598
193 Ga0070679_100007653
194 Ga0070679_100554364
195 Ga0070684_100000002
196 Ga0070684_100130607
197 Ga0070697_100088600
198 Ga0068855_100015495
199 Ga0068856_100021409
200 Ga0068852_100075616
201 Ga0068859_100069572
202 Ga0068859_100290105
203 Ga0068860_100746092
204 Ga0070717_10167004
205 Ga0070717_10512953
206 Ga0068871_100081838
207 Ga0075431_100008001
208 Ga0097620_100069573
209 Ga0097620_100290094
210 Ga0105240_10001086
211 Ga0105240_10200672
212 Ga0105240_10233607
213 Ga0105240_10285054
214 Ga0105240_10678234
215 Ga0105242_10355993
216 Ga0105242_10508801
217 Ga0105248_10067172
218 Ga0105248_10686823
219 Ga0105248_11379759
220 Ga0105237_10125690
221 Ga0105237_10822904
222 Ga0105238_10222535
223 Ga0105239_10144121
224 Ga0157370_10572314
225 Ga0157369_10021450
226 Ga0157369_10038998
227 Ga0157369_10114069
228 Ga0157374_10211988
229 Ga0157374_10418322
230 Ga0157378_10922581
231 Ga0163162_10410173
232 Ga0157372_10034142
233 Ga0157372_10130539
234 Ga0157372_10464149
235 Ga0157375_10164928
236 Ga0157375_10221434
237 Ga0163163_10186334
238 Ga0157376_10151346
239 Ga0157376_10361490
240 Ga0213875_10074642
241 Ga0207699_10151805
242 Ga0207705_10011709
243 Ga0207684_10126388
244 Ga0207684_10159698
245 Ga0207707_10013330
246 Ga0207707_10121504
247 Ga0207695_10005447
248 Ga0207695_10305045
249 Ga0207671_10072243
250 Ga0207693_10253203
251 Ga0207663_10050877
252 Ga0207663_10374172
253 Ga0207652_10041265
254 Ga0207694_10242373
255 Ga0207650_10159587
256 Ga0207670_10412047
257 Ga0207669_10114768
258 Ga0207711_10047751
259 Ga0207661_10000008
260 Ga0207661_10294233
261 Ga0207661_10300377
262 Ga0207667_10145718
263 Ga0207651_10012760
264 Ga0207702_10111957
265 Ga0207641_10188256
266 Ga0207648_10407603
267 Ga0207698_10691921
268 Ga0268266_10451076
269 Ga0268264_10643174
270 Ga0265338_10075451
271 Ga0265762_1006136
272 Ga0265331_10014832
273 Ga0265331_10059901
274 Ga0265316_10001959
275 Ga0265316_10060891
276 Ga0265316_10099450
277 Ga0265316_10200385
278 Ga0265316_10315463
279 Ga0265314_10141501
280 Ga0265342_10045336
281 Ga0373926_0006029
282 Ga0373926_0065434
283 Ga0373931_0288293
284 Ga0373927_0000140
285 Ga0373927_0002929
286 Ga0373927_0443757
287 Ga0373947_0003269
288 Ga0373937_0247505
289 Ga0373937_0285913
290 Ga0373937_0348698
291 Ga0373925_0000288
292 Ga0373925_0106611
293 Ga0436364_0112142
294 Ga0436364_0328380
295 Ga0436364_1513780
296 Ga0436365_0855703
297 Ga0466963_0431953
298 Ga0451576_0065787
299 Ga0495592_0098451
300 Ga0495653_0033531
301 Ga0495580_0012519
302 Ga0495580_0140877
303 Ga0495580_0224205
304 Ga0495580_0314828
305 Ga0495582_0277186
306 Ga0495639_0291275
307 Ga0495662_0012618
308 Ga0495664_0098449
309 Ga0495664_0332594
310 Ga0495594_0191582
311 Ga0495618_0022251
312 Ga0495628_0051561
313 Ga0495628_0202042
314 Ga0495630_0055058
315 Ga0495652_0062519
316 Ga0495665_0211630
317 Ga0495640_0058434
318 Ga0495640_0107179
319 Ga0495587_0274743
320 Ga0495645_0056321
321 Ga0495645_0108888
322 Ga0495645_0201211
323 Ga0495667_0001779
324 Ga0495667_0028359
325 Ga0495667_0363593
326 Ga0495634_0017187
327 Ga0495657_0277195
328 Ga0495599_0001924
329 Ga0495599_0305952
330 Ga0495623_0005479
331 Ga0495613_0058415
332 Ga0495613_0402424
333 Ga0495600_0049037
334 Ga0495604_0024530
335 Ga0495604_0054221
336 Ga0495604_0093490
337 Ga0495604_0170379
338 Ga0495604_0447502
339 Ga0495674_0003052
340 Ga0495674_0039865
341 Ga0495680_0083027
342 Ga0495675_0098274
343 Ga0495675_0168575
344 Ga0495684_0035240
345 Ga0495684_0054493
346 Ga0495684_0153235
347 Ga0495602_0003952
348 Ga0495602_0231037
349 Ga0501048_0210563
350 Ga0495619_0513053
351 Ga0501082_0000532
352 Ga0501082_0743876

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pwv-assembly1.cif.gz_A crystal structure of anthrax lethal factor wild-type protein complexed with an optimised peptide substrate. 0.5219 15 244
6zxl-assembly1.cif.gz_I fully-loaded anthrax lethal toxin in its heptameric pre-pore state and pa7lf(2+1a) arrangement 0.517 27 214
1zxv-assembly2.cif.gz_B x-ray crystal structure of the anthrax lethal factor bound to a small molecule inhibitor, bi-mfm3, 3-{5-[5-(4-chloro-phenyl)-furan-2-ylmethylene]-4-oxo-2-thioxo-thiazolidin-3-yl}-propionic acid. 0.5162 26 220
6zxj-assembly1.cif.gz_H fully-loaded anthrax lethal toxin in its heptameric pre-pore state, in which the third lethal factor is masked out (pa7lf3-masked) 0.5057 53 245
1pwp-assembly2.cif.gz_B crystal structure of the anthrax lethal factor complexed with small molecule inhibitor nsc 12155 0.4998 26 220
ID Description Score Start End Superfamily
af_Q8IRV6_625_735_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.6307 110 149 3.30.2010.10
af_Q86KS1_424_554_3.40.50.12650 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.5476 77 125 3.40.50.12650
af_Q13443_198_405_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.5295 55 142 3.40.390.10
af_I1KNP9_112_278_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.4678 70 141 3.40.50.1010
af_A4IC85_1_351_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.4244 25 243 1.10.1370.30
ID Description Score Start End GO Terms
AF-Q02AZ7-F1-model_v4 Uncharacterized protein 0.953 24 259
AF-A0A3D1AWJ6-F1-model_v4 Uncharacterized protein 0.9281 24 226
AF-A0A2E5FKB6-F1-model_v4 Uncharacterized protein 0.9185 24 263
AF-A0A257VE10-F1-model_v4 Uncharacterized protein 0.9009 27 261
AF-Q02AZ7-F1-model_v4 Uncharacterized protein 0.9009 24 259

Map