F264571

General Info

Members Datasets Scaffolds Average Seq Length
174 109 348 552

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10016403|Ga0157374_100164034
Length 597
Sequence MVKIYIKIKSQTAQRLLIIALFGRFVNRGLVFHHSVFFPYLKHLNLCRMSNSLFRKKSISKIIQDAETGLGDGHGPEGLRRVLNVRDLTFMGIAAVVGAGIFSTIGTAAFNGGPGISLLFVITAVTCGFSALCYAEFASRVPIAGSAYTYAYVSFGELIAWIIGWALILEYAIGNIVVAISWSGYFNNLLEGFGLHLPAWLTTDPNTAKAAFLKAQEAMQAGTTLNENLVFAQNAWNNSPVIAGTHIFVNLPAFIIVCFISALTYIGIKESKKMTNFLVVFKILVIXXXXIMGFFFVQPSNWSPFMPNGFQGVLKGVSAVFYAYIGFDAISTTAEECRNPQRDLPRGMIYSLIICTVLYILIAFVLTGMVPFTELKVADPLAFVFDRVGQKWIGYIVSISAVVATTSVLLVFQLGQPRIWMSMSRDGLLPKAFGKIHPKYQTPWFSTIVTGIMVAVPSLFMESSLMTDLTSIGTLFAFVLVSGGVLALPRVINLKGDPNPGGKFRLPYINGKWIVPVLYIIFVFLSRQRIAASFQNMGSEGLQERSYSIIPIMGVLFCAYLLIEIPAVSWMYFFVWMAIGLTIYFLYGYRKSKLAGG

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
72 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
88 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
89 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
99 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
100 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
104 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
105 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
106 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
107 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
108 2818991444 Filimonas endophytica 3197 Isolate Unclassified
109 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.32
Nodule 0
Rhizoplane 0.57
Rhizosphere 88.51
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10016403 3300013296 Bacteria 6510
2 SwRhRL2b_contig_1496964 2162886007 Bacteria 130484
3 rootH2_10021082 3300003320 Bacteria 9476
4 JGI25160J50197_1002574 3300003354 Bacteria 8383
5 Ga0065704_10070178 3300005289 Bacteria 132449
6 Ga0070683_100006694 3300005329 Bacteria 9676
7 Ga0070680_100018288 3300005336 Bacteria 5534
8 Ga0068868_100008995 3300005338 Bacteria 7168
9 Ga0070671_100015211 3300005355 Bacteria 6214
10 Ga0070667_100004254 3300005367 Bacteria 12089
11 Ga0070707_100000810 3300005468 Bacteria 30928
12 Ga0070679_100027289 3300005530 Bacteria 5618
13 Ga0068853_100000201 3300005539 Bacteria 41960
14 Ga0070665_100000016 3300005548 Bacteria 451538
15 Ga0070665_100014748 3300005548 Bacteria 7843
16 Ga0068855_100006744 3300005563 Bacteria 13924
17 Ga0068855_100007502 3300005563 Bacteria 13204
18 Ga0068857_100007164 3300005577 Bacteria 9608
19 Ga0068857_100015195 3300005577 Bacteria 6717
20 Ga0068856_100009867 3300005614 Bacteria 9272
21 Ga0068852_100001385 3300005616 Bacteria 16298
22 Ga0068860_100000026 3300005843 Bacteria 270483
23 Ga0068860_100004105 3300005843 Bacteria 14912
24 Ga0097621_100001126 3300006237 Bacteria 18630
25 Ga0068871_100001247 3300006358 Bacteria 16998
26 Ga0105240_10000078 3300009093 Bacteria 196646
27 Ga0105240_10000715 3300009093 Bacteria 60725
28 Ga0105240_10001556 3300009093 Bacteria 38962
29 Ga0105240_10001801 3300009093 Bacteria 36072
30 Ga0105240_10003107 3300009093 Bacteria 26115
31 Ga0105240_10011725 3300009093 Bacteria 12177
32 Ga0105240_10047655 3300009093 Bacteria 5421
33 Ga0105240_10061340 3300009093 Bacteria 4686
34 Ga0105240_10086893 3300009093 Bacteria 3830
35 Ga0111539_10008670 3300009094 Bacteria 12908
36 Ga0105241_10001477 3300009174 Bacteria 18004
37 Ga0105241_10033925 3300009174 Bacteria 3833
38 Ga0105237_10001522 3300009545 Bacteria 30383
39 Ga0105237_10004392 3300009545 Bacteria 16347
40 Ga0105237_10004911 3300009545 Bacteria 15298
41 Ga0105237_10007550 3300009545 Bacteria 11883
42 Ga0105237_10046294 3300009545 Bacteria 4375
43 Ga0105238_10001372 3300009551 Bacteria 24425
44 Ga0105238_10103406 3300009551 Bacteria 2830
45 Ga0105249_10057759 3300009553 Bacteria 3555
46 Ga0105239_10001215 3300010375 Bacteria 35099
47 Ga0105239_10035915 3300010375 Bacteria 5441
48 Ga0105239_10126101 3300010375 Unclassified 2845
49 Ga0157371_10010151 3300013102 Bacteria 7356
50 Ga0157370_10031300 3300013104 Bacteria 5206
51 Ga0157369_10248128 3300013105 Bacteria 1858
52 Ga0157374_10000002 3300013296 Bacteria 1054226
53 Ga0157378_10001868 3300013297 Bacteria 18908
54 Ga0157378_10020772 3300013297 Bacteria 5774
55 Ga0157378_10023262 3300013297 Bacteria 5453
56 Ga0157378_10145793 3300013297 Bacteria 2202
57 Ga0163162_10004340 3300013306 Bacteria 13649
58 Ga0163162_10005557 3300013306 Bacteria 12193
59 Ga0163162_10009744 3300013306 Bacteria 9352
60 Ga0163162_10014936 3300013306 Bacteria 7583
61 Ga0157372_10000666 3300013307 Bacteria 37795
62 Ga0157372_10001284 3300013307 Bacteria 27122
63 Ga0157372_10013500 3300013307 Bacteria 8730
64 Ga0157372_10027747 3300013307 Bacteria 6170
65 Ga0157372_10029543 3300013307 Bacteria 5986
66 Ga0157375_10002063 3300013308 Bacteria 17354
67 Ga0157376_10000779 3300014969 Bacteria 20826
68 Ga0157376_10030287 3300014969 Bacteria 4320
69 Ga0207426_1000002 3300025302 Bacteria 1249660
70 Ga0207647_10012377 3300025904 Bacteria 5940
71 Ga0207654_10016065 3300025911 Bacteria 3893
72 Ga0207654_10041030 3300025911 Bacteria 2611
73 Ga0207707_10038692 3300025912 Bacteria 4168
74 Ga0207707_10065240 3300025912 Bacteria 3171
75 Ga0207695_10000064 3300025913 Bacteria 346010
76 Ga0207695_10000327 3300025913 Bacteria 113436
77 Ga0207695_10000486 3300025913 Bacteria 84856
78 Ga0207695_10000681 3300025913 Bacteria 66668
79 Ga0207695_10011650 3300025913 Bacteria 10626
80 Ga0207695_10019530 3300025913 Bacteria 7799
81 Ga0207695_10063112 3300025913 Bacteria 3820
82 Ga0207671_10000198 3300025914 Bacteria 93274
83 Ga0207671_10006336 3300025914 Bacteria 10558
84 Ga0207671_10008746 3300025914 Bacteria 8532
85 Ga0207671_10023028 3300025914 Bacteria 4701
86 Ga0207660_10011653 3300025917 Bacteria 5733
87 Ga0207652_10084893 3300025921 Bacteria 2774
88 Ga0207646_10001923 3300025922 Bacteria 24973
89 Ga0207694_10013109 3300025924 Bacteria 6242
90 Ga0207694_10087291 3300025924 Bacteria 2457
91 Ga0207644_10024617 3300025931 Bacteria 4134
92 Ga0207661_10014230 3300025944 Bacteria 5825
93 Ga0207667_10000352 3300025949 Bacteria 62572
94 Ga0207667_10009524 3300025949 Bacteria 11429
95 Ga0207667_10020925 3300025949 Bacteria 7256
96 Ga0207712_10038041 3300025961 Bacteria 3288
97 Ga0207658_10005723 3300025986 Bacteria 8499
98 Ga0207639_10013475 3300026041 Bacteria 5724
99 Ga0207639_10096464 3300026041 Bacteria 2379
100 Ga0207674_10003537 3300026116 Bacteria 19078
101 Ga0268266_10000034 3300028379 Bacteria 354251
102 Ga0268266_10002462 3300028379 Bacteria 19795
103 Ga0268264_10000436 3300028381 Bacteria 57473
104 Ga0268264_10002800 3300028381 Bacteria 15244
105 Ga0268264_10047778 3300028381 Bacteria 3559
106 Ga0307517_10001430 3300028786 Bacteria 40142
107 Ga0307515_10000009 3300028794 Bacteria 653206
108 Ga0307511_10000265 3300030521 Bacteria 54237
109 Ga0265327_10000009 3300031251 Bacteria 616360
110 Ga0265327_10046375 3300031251 Bacteria 2301
111 Ga0307408_100001616 3300031548 Bacteria 16678
112 Ga0307408_100007868 3300031548 Bacteria 7047
113 Ga0307408_100033639 3300031548 Bacteria 3583
114 Ga0265313_10009044 3300031595 Bacteria 6522
115 Ga0307516_10000749 3300031730 Bacteria 44209
116 Ga0307405_10024014 3300031731 Bacteria 3476
117 Ga0307413_10005900 3300031824 Bacteria 5531
118 Ga0307412_10006603 3300031911 Bacteria 6568
119 Ga0307412_10023944 3300031911 Bacteria 3764
120 Ga0307416_100003078 3300032002 Bacteria 9757
121 Ga0307416_100011563 3300032002 Bacteria 5895
122 Ga0307415_100002870 3300032126 Bacteria 8625
123 Ga0307510_10009936 3300033180 Bacteria 11310
124 Ga0395899_0000002 3300037312 Bacteria 1324310
125 Ga0395905_0195779 3300037471 Bacteria 1895
126 Ga0439439_0000963 3300041406 Bacteria 5383
127 Ga0439434_0001581 3300042435 Bacteria 6573
128 Ga0451577_0034117 3300042876 Bacteria 4589
129 Ga0466969_0011172 3300044656 Bacteria 4754
130 Ga0466972_0005527 3300044658 Bacteria 6331
131 Ga0466964_0013393 3300044706 Bacteria 3112
132 Ga0466971_0029385 3300044719 Bacteria 2459
133 Ga0466968_0010809 3300044735 Bacteria 3547
134 Ga0466970_0048139 3300044765 Bacteria 2273
135 Ga0466959_0000039 3300045049 Bacteria 101186
136 Ga0466959_0001334 3300045049 Bacteria 15018
137 Ga0451576_0037935 3300045051 Bacteria 5102
138 Ga0466958_0020868 3300045836 Bacteria 3824
139 Ga0495606_0007030 3300046507 Bacteria 10205
140 Ga0495608_0014705 3300046511 Bacteria 5431
141 Ga0495648_0002336 3300046524 Bacteria 17615
142 Ga0495667_0002385 3300046559 Bacteria 12561
143 Ga0495636_0000020 3300047318 Bacteria 75085
144 Ga0495687_000079 3300047443 Bacteria 147704
145 Ga0495686_0000041 3300047472 Bacteria 297599
146 Ga0496114_0000296 3300048917 Bacteria 36568
147 Ga0501031_0007370 3300049568 Bacteria 7171
148 Ga0501032_0124556 3300049569 Bacteria 1703
149 Ga0501034_0000043 3300049571 Bacteria 229049
150 Ga0501034_0080718 3300049571 Bacteria 3256
151 Ga0501036_0093026 3300049572 Bacteria 2547
152 Ga0501038_0010356 3300049574 Bacteria 8532
153 Ga0501038_0022682 3300049574 Bacteria 5620
154 Ga0501043_0010608 3300049579 Bacteria 7215
155 Ga0501043_0024352 3300049579 Bacteria 4750
156 Ga0501047_0092029 3300049581 Bacteria 2911
157 Ga0501202_001100 3300049652 Bacteria 4209
158 Ga0501235_004933 3300049669 Bacteria 2893
159 Ga0501225_0003717 3300049705 Bacteria 4594
160 Ga0501035_0016758 3300049822 Bacteria 6757
161 Ga0501035_0107116 3300049822 Bacteria 2450
162 Ga0501044_0017437 3300049823 Bacteria 7704
163 Ga0501044_0060324 3300049823 Bacteria 3884
164 nmdc:mga00v17_20431_c1 3300050491 Bacteria 3793
165 Ga0500583_0001160 3300053092 Bacteria 7511
166 Ga0500562_000020 3300053108 Bacteria 113686
167 Ga0500655_005924 3300053133 Bacteria 2201
168 Ga0500622_0000163 3300053156 Bacteria 70679
169 Ga0500622_0000467 3300053156 Bacteria 38187
170 Ga0500622_0000557 3300053156 Bacteria 34131
171 Ga0500622_0000581 3300053156 Bacteria 33098
172 Ga0500622_0011011 3300053156 Bacteria 4935
173 2819588327 2818991444 Bacteria 6968812
174 2929156466 2929154850 Bacteria 6753285
175 Ga0157374_10016403
176 SwRhRL2b_contig_1496964
177 rootH2_10021082
178 JGI25160J50197_1002574
179 Ga0065704_10070178
180 Ga0070683_100006694
181 Ga0070680_100018288
182 Ga0068868_100008995
183 Ga0070671_100015211
184 Ga0070667_100004254
185 Ga0070707_100000810
186 Ga0070679_100027289
187 Ga0068853_100000201
188 Ga0070665_100000016
189 Ga0070665_100014748
190 Ga0068855_100006744
191 Ga0068855_100007502
192 Ga0068857_100007164
193 Ga0068857_100015195
194 Ga0068856_100009867
195 Ga0068852_100001385
196 Ga0068860_100000026
197 Ga0068860_100004105
198 Ga0097621_100001126
199 Ga0068871_100001247
200 Ga0105240_10000078
201 Ga0105240_10000715
202 Ga0105240_10001556
203 Ga0105240_10001801
204 Ga0105240_10003107
205 Ga0105240_10011725
206 Ga0105240_10047655
207 Ga0105240_10061340
208 Ga0105240_10086893
209 Ga0111539_10008670
210 Ga0105241_10001477
211 Ga0105241_10033925
212 Ga0105237_10001522
213 Ga0105237_10004392
214 Ga0105237_10004911
215 Ga0105237_10007550
216 Ga0105237_10046294
217 Ga0105238_10001372
218 Ga0105238_10103406
219 Ga0105249_10057759
220 Ga0105239_10001215
221 Ga0105239_10035915
222 Ga0105239_10126101
223 Ga0157371_10010151
224 Ga0157370_10031300
225 Ga0157369_10248128
226 Ga0157374_10000002
227 Ga0157378_10001868
228 Ga0157378_10020772
229 Ga0157378_10023262
230 Ga0157378_10145793
231 Ga0163162_10004340
232 Ga0163162_10005557
233 Ga0163162_10009744
234 Ga0163162_10014936
235 Ga0157372_10000666
236 Ga0157372_10001284
237 Ga0157372_10013500
238 Ga0157372_10027747
239 Ga0157372_10029543
240 Ga0157375_10002063
241 Ga0157376_10000779
242 Ga0157376_10030287
243 Ga0207426_1000002
244 Ga0207647_10012377
245 Ga0207654_10016065
246 Ga0207654_10041030
247 Ga0207707_10038692
248 Ga0207707_10065240
249 Ga0207695_10000064
250 Ga0207695_10000327
251 Ga0207695_10000486
252 Ga0207695_10000681
253 Ga0207695_10011650
254 Ga0207695_10019530
255 Ga0207695_10063112
256 Ga0207671_10000198
257 Ga0207671_10006336
258 Ga0207671_10008746
259 Ga0207671_10023028
260 Ga0207660_10011653
261 Ga0207652_10084893
262 Ga0207646_10001923
263 Ga0207694_10013109
264 Ga0207694_10087291
265 Ga0207644_10024617
266 Ga0207661_10014230
267 Ga0207667_10000352
268 Ga0207667_10009524
269 Ga0207667_10020925
270 Ga0207712_10038041
271 Ga0207658_10005723
272 Ga0207639_10013475
273 Ga0207639_10096464
274 Ga0207674_10003537
275 Ga0268266_10000034
276 Ga0268266_10002462
277 Ga0268264_10000436
278 Ga0268264_10002800
279 Ga0268264_10047778
280 Ga0307517_10001430
281 Ga0307515_10000009
282 Ga0307511_10000265
283 Ga0265327_10000009
284 Ga0265327_10046375
285 Ga0307408_100001616
286 Ga0307408_100007868
287 Ga0307408_100033639
288 Ga0265313_10009044
289 Ga0307516_10000749
290 Ga0307405_10024014
291 Ga0307413_10005900
292 Ga0307412_10006603
293 Ga0307412_10023944
294 Ga0307416_100003078
295 Ga0307416_100011563
296 Ga0307415_100002870
297 Ga0307510_10009936
298 Ga0395899_0000002
299 Ga0395905_0195779
300 Ga0439439_0000963
301 Ga0439434_0001581
302 Ga0451577_0034117
303 Ga0466969_0011172
304 Ga0466972_0005527
305 Ga0466964_0013393
306 Ga0466971_0029385
307 Ga0466968_0010809
308 Ga0466970_0048139
309 Ga0466959_0000039
310 Ga0466959_0001334
311 Ga0451576_0037935
312 Ga0466958_0020868
313 Ga0495606_0007030
314 Ga0495608_0014705
315 Ga0495648_0002336
316 Ga0495667_0002385
317 Ga0495636_0000020
318 Ga0495687_000079
319 Ga0495686_0000041
320 Ga0496114_0000296
321 Ga0501031_0007370
322 Ga0501032_0124556
323 Ga0501034_0000043
324 Ga0501034_0080718
325 Ga0501036_0093026
326 Ga0501038_0010356
327 Ga0501038_0022682
328 Ga0501043_0010608
329 Ga0501043_0024352
330 Ga0501047_0092029
331 Ga0501202_001100
332 Ga0501235_004933
333 Ga0501225_0003717
334 Ga0501035_0016758
335 Ga0501035_0107116
336 Ga0501044_0017437
337 Ga0501044_0060324
338 nmdc:mga00v17_20431_c1
339 Ga0500583_0001160
340 Ga0500562_000020
341 Ga0500655_005924
342 Ga0500622_0000163
343 Ga0500622_0000467
344 Ga0500622_0000557
345 Ga0500622_0000581
346 Ga0500622_0011011
347 2819588327
348 2929156466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13906

AA_permease_C

C-terminus of AA_permease

547

592

0.97

PF00324

AA_permease

Amino acid permease

87

572

0.93

PF13520

AA_permease_2

Amino acid permease

83

558

0.84

PF03845

Spore_permease

Spore germination protein

240

379

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f34-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. 0.9276 4 556
5oqt-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue 0.9256 6 556
6f34-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. 0.9218 4 556
5oqt-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue 0.9198 6 556
6f2g-assembly1.cif.gz_A bacterial asc transporter crystal structure in open to in conformation 0.8621 36 555
ID Description Score Start End Superfamily
af_P71892_30_474_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9421 32 559 1.20.1740.10
af_P71892_30_474_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9339 32 559 1.20.1740.10
af_P9WQM3_13_431_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8893 30 548 1.20.1740.10
af_Q2G1Y2_23_478_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.888 32 559 1.20.1740.10
af_Q4CYX3_37_503_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8849 31 559 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A1W1VKD8-F1-model_v4 Amino acid/polyamine/organocation transporter, APC superfamily 0.9603 1 559 GO:0015171
GO:0016020
AF-A0A4U3B1Y3-F1-model_v4 deleted 0.9593 94 397
AF-A0A4U3B1Y3-F1-model_v4 deleted 0.956 94 397
AF-A0A0R2H023-F1-model_v4 APC family amino acid-polyamine-organocation transporter 0.9533 1 558 GO:0015171
GO:0016020
AF-Q97FG8-F1-model_v4 Amino acid transporter 0.9524 4 347 GO:0015171
GO:0016020

Map