F260337

General Info

Members Datasets Scaffolds Average Seq Length
172 97 340 310

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100384551|Ga0070697_1003845511
Length 326
Sequence MTDLASQFHFASAPDSWGVLDYPGPSWNQPYEKMLDEMVEAGYTGTELGPYGFFPTDPAVLKPQLDQRRLKLLGSFVPVVLSDPVSAGVAVAQICKVGNLLATLKAPFLVLADAQSDERDRISGRVPADGSSSLTAAQWKNVARVVEEAARVASDFGLDLVFHPHVATYVETPEECERFFDVTSHSGIGLCLDTGHCVFGGGDTIAEAGKFRSVLRFVHIKDVDAKILEQSRRRKLTFEQAIEEKVFTIIGQGSIDFPALFGLLVKNNYSGWMVVEQEVKFGATVIPPAENIAASLKYLRGVVSSLAGRDNSTVTRRRGPVGRSLL

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
56 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
97 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.26
Metatranscriptomes 1.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.91
Rhizosphere 94.19
Stem 0
Stem Tuber 0
Unclassified 16.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100384551 3300005536 Unclassified 1216
2 rootH1_10294493 3300003323 Bacteria 4919
3 Ga0068869_100001727 3300005334 Bacteria 13054
4 Ga0068868_100383340 3300005338 Unclassified 1210
5 Ga0070675_100292361 3300005354 Bacteria 1434
6 Ga0070709_10026411 3300005434 Bacteria 3442
7 Ga0070709_10050065 3300005434 Bacteria 2615
8 Ga0070709_10101714 3300005434 Bacteria 1916
9 Ga0070709_10204741 3300005434 Bacteria 1399
10 Ga0070714_100405411 3300005435 Unclassified 1289
11 Ga0070713_100027090 3300005436 Bacteria 4509
12 Ga0070713_100086509 3300005436 Bacteria 2688
13 Ga0070710_10044240 3300005437 Bacteria 2470
14 Ga0070710_10053402 3300005437 Bacteria 2276
15 Ga0070711_100003645 3300005439 Bacteria 9000
16 Ga0070711_100004068 3300005439 Bacteria 8596
17 Ga0070711_100012114 3300005439 Bacteria 5378
18 Ga0070711_100029335 3300005439 Bacteria 3629
19 Ga0070708_100000882 3300005445 Bacteria 22663
20 Ga0070708_100022453 3300005445 Bacteria 5353
21 Ga0070708_100023718 3300005445 Bacteria 5219
22 Ga0070681_10228055 3300005458 Bacteria 1777
23 Ga0070685_10117834 3300005466 Unclassified 1645
24 Ga0070706_100011062 3300005467 Bacteria 8379
25 Ga0070707_100001006 3300005468 Bacteria 27918
26 Ga0070707_100099451 3300005468 Bacteria 2818
27 Ga0070707_100115647 3300005468 Bacteria 2603
28 Ga0070707_100155042 3300005468 Unclassified 2231
29 Ga0070707_100223824 3300005468 Bacteria 1832
30 Ga0070698_100000903 3300005471 Bacteria 32615
31 Ga0070698_100085699 3300005471 Unclassified 3137
32 Ga0070698_100469721 3300005471 Unclassified 1194
33 Ga0070699_100000604 3300005518 Bacteria 33879
34 Ga0070699_100095859 3300005518 Unclassified 2598
35 Ga0070699_100104721 3300005518 Bacteria 2481
36 Ga0070699_100167570 3300005518 Bacteria 1946
37 Ga0070679_100124378 3300005530 Bacteria 2562
38 Ga0070697_100001222 3300005536 Bacteria 19389
39 Ga0070697_100002827 3300005536 Bacteria 13355
40 Ga0070697_100145176 3300005536 Bacteria 1997
41 Ga0070665_100023774 3300005548 Bacteria 6173
42 Ga0070665_100086693 3300005548 Bacteria 3136
43 Ga0068855_100508901 3300005563 Unclassified 1308
44 Ga0068856_100044096 3300005614 Unclassified 4388
45 Ga0068863_100085845 3300005841 Bacteria 2982
46 Ga0068858_100006108 3300005842 Bacteria 11749
47 Ga0068858_100223828 3300005842 Bacteria 1783
48 Ga0081455_10174170 3300005937 Bacteria 1635
49 Ga0070717_10032404 3300006028 Bacteria 4211
50 Ga0070717_10046487 3300006028 Bacteria 3551
51 Ga0070715_10004304 3300006163 Bacteria 4649
52 Ga0070715_10016214 3300006163 Unclassified 2795
53 Ga0070716_100000944 3300006173 Bacteria 12581
54 Ga0070712_100000950 3300006175 Bacteria 17422
55 Ga0070712_100051334 3300006175 Bacteria 2872
56 Ga0070712_100067933 3300006175 Bacteria 2538
57 Ga0070712_100120040 3300006175 Bacteria 1977
58 Ga0070712_100133541 3300006175 Archaea 1884
59 Ga0097621_100014614 3300006237 Bacteria 5883
60 Ga0097621_100105857 3300006237 Bacteria 2372
61 Ga0068871_100024489 3300006358 Unclassified 4683
62 Ga0068871_100081660 3300006358 Archaea 2678
63 Ga0068871_100556171 3300006358 Bacteria 1040
64 Ga0075434_100233423 3300006871 Bacteria 1859
65 Ga0068865_100035014 3300006881 Bacteria 3374
66 Ga0075436_100004908 3300006914 Bacteria 9190
67 Ga0075435_100081879 3300007076 Bacteria 2652
68 Ga0105240_10044827 3300009093 Bacteria 5615
69 Ga0105240_10182091 3300009093 Unclassified 2479
70 Ga0105245_10331466 3300009098 Unclassified 1502
71 Ga0105247_10219208 3300009101 Bacteria 1287
72 Ga0105241_10002228 3300009174 Bacteria 14577
73 Ga0105241_10323067 3300009174 Unclassified 1331
74 Ga0105242_10187964 3300009176 Bacteria 1827
75 Ga0105248_10081800 3300009177 Unclassified 3631
76 Ga0105237_10030431 3300009545 Bacteria 5483
77 Ga0105237_10068300 3300009545 Bacteria 3548
78 Ga0105237_10069850 3300009545 Bacteria 3508
79 Ga0105238_10544324 3300009551 Bacteria 1165
80 Ga0105249_10134628 3300009553 Bacteria 2363
81 Ga0105239_10363262 3300010375 Bacteria 1635
82 Ga0157373_10004882 3300013100 Bacteria 10092
83 Ga0157370_10062676 3300013104 Archaea 3525
84 Ga0157374_10076907 3300013296 Unclassified 3157
85 Ga0157378_10006243 3300013297 Bacteria 10434
86 Ga0157378_10207693 3300013297 Bacteria 1855
87 Ga0163162_10005475 3300013306 Bacteria 12271
88 Ga0157372_10007638 3300013307 Bacteria 11499
89 Ga0157372_10024185 3300013307 Bacteria 6594
90 Ga0163163_10330362 3300014325 Bacteria 1579
91 Ga0157377_10092526 3300014745 Bacteria 1788
92 Ga0157379_10004136 3300014968 Bacteria 12383
93 Ga0157379_10088981 3300014968 Plasmid 2769
94 Ga0157379_10089874 3300014968 Bacteria 2755
95 Ga0157376_10000010 3300014969 Bacteria 311693
96 Ga0157376_10398352 3300014969 Bacteria 1330
97 Ga0224572_1016532 3300024225 Bacteria 1415
98 Ga0228598_1000058 3300024227 Bacteria 16145
99 Ga0228598_1000084 3300024227 Bacteria 14767
100 Ga0228598_1001056 3300024227 Unclassified 6066
101 Ga0207692_10061932 3300025898 Bacteria 1941
102 Ga0207685_10052775 3300025905 Bacteria 1576
103 Ga0207699_10019641 3300025906 Bacteria 3608
104 Ga0207699_10039391 3300025906 Bacteria 2715
105 Ga0207699_10079642 3300025906 Bacteria 2027
106 Ga0207684_10000768 3300025910 Bacteria 37301
107 Ga0207654_10009607 3300025911 Unclassified 4917
108 Ga0207695_10212927 3300025913 Bacteria 1842
109 Ga0207693_10002583 3300025915 Bacteria 15731
110 Ga0207693_10014887 3300025915 Bacteria 6248
111 Ga0207693_10139299 3300025915 Archaea 1908
112 Ga0207693_10220802 3300025915 Unclassified 1489
113 Ga0207663_10011843 3300025916 Bacteria 4695
114 Ga0207663_10026892 3300025916 Bacteria 3345
115 Ga0207663_10032035 3300025916 Bacteria 3117
116 Ga0207663_10193547 3300025916 Bacteria 1462
117 Ga0207646_10006318 3300025922 Bacteria 12281
118 Ga0207646_10041353 3300025922 Bacteria 4144
119 Ga0207646_10064887 3300025922 Bacteria 3259
120 Ga0207646_10100756 3300025922 Bacteria 2589
121 Ga0207700_10068558 3300025928 Bacteria 2720
122 Ga0207700_10128452 3300025928 Bacteria 2065
123 Ga0207664_10056993 3300025929 Bacteria 3105
124 Ga0207664_10105532 3300025929 Unclassified 2335
125 Ga0207664_10142185 3300025929 Bacteria 2031
126 Ga0207665_10000168 3300025939 Bacteria 44472
127 Ga0207711_10178153 3300025941 Bacteria 1932
128 Ga0207689_10003213 3300025942 Bacteria 14969
129 Ga0207667_10318372 3300025949 Bacteria 1589
130 Ga0207640_10201777 3300025981 Bacteria 1508
131 Ga0207677_10041747 3300026023 Bacteria 3036
132 Ga0207702_10020591 3300026078 Bacteria 5460
133 Ga0268266_10017007 3300028379 Bacteria 6213
134 Ga0268266_10041650 3300028379 Bacteria 3919
135 Ga0268264_10167576 3300028381 Bacteria 1984
136 Ga0265338_10008156 3300028800 Bacteria 12778
137 Ga0265338_10012493 3300028800 Bacteria 9677
138 Ga0265338_10241535 3300028800 Unclassified 1337
139 Ga0265338_10300948 3300028800 Bacteria 1166
140 Ga0265762_1000296 3300030760 Bacteria 8366
141 Ga0265760_10008189 3300031090 Bacteria 2987
142 Ga0265760_10018082 3300031090 Bacteria 2027
143 Ga0265325_10019495 3300031241 Unclassified 3748
144 Ga0265339_10047717 3300031249 Bacteria 2351
145 Ga0265339_10143334 3300031249 Bacteria 1214
146 Ga0373936_0073133 3300035113 Bacteria 1416
147 Ga0373927_0108920 3300035695 Bacteria 1805
148 Ga0373927_0261119 3300035695 Bacteria 1139
149 Ga0373947_0110834 3300035725 Bacteria 1734
150 Ga0373937_0107744 3300036401 Unclassified 2591
151 Ga0373937_0590004 3300036401 Unclassified 1055
152 Ga0373925_0008673 3300037068 Bacteria 7408
153 Ga0373925_0044218 3300037068 Bacteria 3307
154 Ga0436364_1563170 3300037853 Bacteria 5591
155 Ga0436362_0363206 3300039453 Bacteria 5106
156 Ga0453683_0034150 3300044673 Bacteria 3207
157 Ga0495580_0005694 3300046472 Bacteria 10249
158 Ga0495580_0010625 3300046472 Bacteria 7158
159 Ga0495580_0028273 3300046472 Unclassified 4077
160 Ga0495580_0201236 3300046472 Bacteria 1372
161 Ga0496102_0362958 3300048905 Bacteria 1364
162 Ga0496104_0256552 3300048907 Bacteria 1661
163 Ga0496104_0559080 3300048907 Unclassified 1055
164 Ga0496112_0023554 3300048915 Bacteria 5884
165 Ga0496115_0071035 3300048918 Bacteria 2823
166 Ga0496126_0002283 3300048929 Bacteria 26414
167 Ga0496126_0024997 3300048929 Bacteria 5757
168 Ga0496126_0429367 3300048929 Unclassified 1067
169 nmdc:mga0n895_732744_c1 3300050512 Unclassified 983
170 nmdc:mga08x19_3898_c1 3300050514 Bacteria 8876
171 Ga0070697_100384551
172 rootH1_10294493
173 Ga0068869_100001727
174 Ga0068868_100383340
175 Ga0070675_100292361
176 Ga0070709_10026411
177 Ga0070709_10050065
178 Ga0070709_10101714
179 Ga0070709_10204741
180 Ga0070714_100405411
181 Ga0070713_100027090
182 Ga0070713_100086509
183 Ga0070710_10044240
184 Ga0070710_10053402
185 Ga0070711_100003645
186 Ga0070711_100004068
187 Ga0070711_100012114
188 Ga0070711_100029335
189 Ga0070708_100000882
190 Ga0070708_100022453
191 Ga0070708_100023718
192 Ga0070681_10228055
193 Ga0070685_10117834
194 Ga0070706_100011062
195 Ga0070707_100001006
196 Ga0070707_100099451
197 Ga0070707_100115647
198 Ga0070707_100155042
199 Ga0070707_100223824
200 Ga0070698_100000903
201 Ga0070698_100085699
202 Ga0070698_100469721
203 Ga0070699_100000604
204 Ga0070699_100095859
205 Ga0070699_100104721
206 Ga0070699_100167570
207 Ga0070679_100124378
208 Ga0070697_100001222
209 Ga0070697_100002827
210 Ga0070697_100145176
211 Ga0070665_100023774
212 Ga0070665_100086693
213 Ga0068855_100508901
214 Ga0068856_100044096
215 Ga0068863_100085845
216 Ga0068858_100006108
217 Ga0068858_100223828
218 Ga0081455_10174170
219 Ga0070717_10032404
220 Ga0070717_10046487
221 Ga0070715_10004304
222 Ga0070715_10016214
223 Ga0070716_100000944
224 Ga0070712_100000950
225 Ga0070712_100051334
226 Ga0070712_100067933
227 Ga0070712_100120040
228 Ga0070712_100133541
229 Ga0097621_100014614
230 Ga0097621_100105857
231 Ga0068871_100024489
232 Ga0068871_100081660
233 Ga0068871_100556171
234 Ga0075434_100233423
235 Ga0068865_100035014
236 Ga0075436_100004908
237 Ga0075435_100081879
238 Ga0105240_10044827
239 Ga0105240_10182091
240 Ga0105245_10331466
241 Ga0105247_10219208
242 Ga0105241_10002228
243 Ga0105241_10323067
244 Ga0105242_10187964
245 Ga0105248_10081800
246 Ga0105237_10030431
247 Ga0105237_10068300
248 Ga0105237_10069850
249 Ga0105238_10544324
250 Ga0105249_10134628
251 Ga0105239_10363262
252 Ga0157373_10004882
253 Ga0157370_10062676
254 Ga0157374_10076907
255 Ga0157378_10006243
256 Ga0157378_10207693
257 Ga0163162_10005475
258 Ga0157372_10007638
259 Ga0157372_10024185
260 Ga0163163_10330362
261 Ga0157377_10092526
262 Ga0157379_10004136
263 Ga0157379_10088981
264 Ga0157379_10089874
265 Ga0157376_10000010
266 Ga0157376_10398352
267 Ga0224572_1016532
268 Ga0228598_1000058
269 Ga0228598_1000084
270 Ga0228598_1001056
271 Ga0207692_10061932
272 Ga0207685_10052775
273 Ga0207699_10019641
274 Ga0207699_10039391
275 Ga0207699_10079642
276 Ga0207684_10000768
277 Ga0207654_10009607
278 Ga0207695_10212927
279 Ga0207693_10002583
280 Ga0207693_10014887
281 Ga0207693_10139299
282 Ga0207693_10220802
283 Ga0207663_10011843
284 Ga0207663_10026892
285 Ga0207663_10032035
286 Ga0207663_10193547
287 Ga0207646_10006318
288 Ga0207646_10041353
289 Ga0207646_10064887
290 Ga0207646_10100756
291 Ga0207700_10068558
292 Ga0207700_10128452
293 Ga0207664_10056993
294 Ga0207664_10105532
295 Ga0207664_10142185
296 Ga0207665_10000168
297 Ga0207711_10178153
298 Ga0207689_10003213
299 Ga0207667_10318372
300 Ga0207640_10201777
301 Ga0207677_10041747
302 Ga0207702_10020591
303 Ga0268266_10017007
304 Ga0268266_10041650
305 Ga0268264_10167576
306 Ga0265338_10008156
307 Ga0265338_10012493
308 Ga0265338_10241535
309 Ga0265338_10300948
310 Ga0265762_1000296
311 Ga0265760_10008189
312 Ga0265760_10018082
313 Ga0265325_10019495
314 Ga0265339_10047717
315 Ga0265339_10143334
316 Ga0373936_0073133
317 Ga0373927_0108920
318 Ga0373927_0261119
319 Ga0373947_0110834
320 Ga0373937_0107744
321 Ga0373937_0590004
322 Ga0373925_0008673
323 Ga0373925_0044218
324 Ga0436364_1563170
325 Ga0436362_0363206
326 Ga0453683_0034150
327 Ga0495580_0005694
328 Ga0495580_0010625
329 Ga0495580_0028273
330 Ga0495580_0201236
331 Ga0496102_0362958
332 Ga0496104_0256552
333 Ga0496104_0559080
334 Ga0496112_0023554
335 Ga0496115_0071035
336 Ga0496126_0002283
337 Ga0496126_0024997
338 Ga0496126_0429367
339 nmdc:mga0n895_732744_c1
340 nmdc:mga08x19_3898_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

35

302

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cny-assembly2.cif.gz_B crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution 0.9075 1 300
3cny-assembly2.cif.gz_B crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution 0.8844 1 300
5hmq-assembly1.cif.gz_C xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.8285 6 302
5hmq-assembly3.cif.gz_D xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.8283 6 302
5hmq-assembly1.cif.gz_A xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.823 6 302
ID Description Score Start End Superfamily
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8934 1 300 3.20.20.150
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8733 1 300 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8234 6 303 3.20.20.150
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8064 32 301 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8023 9 301 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2V9NZF4-F1-model_v4 Xylose isomerase 0.9885 142 303 GO:0016853
AF-A0A2V9Y0K8-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9769 1 310
AF-A0A2Z5G194-F1-model_v4 Inosose dehydratase 0.9734 34 306
AF-A0A2V9Y0K8-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9707 1 310
AF-A0A352MH45-F1-model_v4 Xylose isomerase 0.9704 162 279 GO:0016853

Map