F256427

General Info

Members Datasets Scaffolds Average Seq Length
170 145 153 302

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100283510|Ga0068863_1002835102
Length 338
Sequence MINARNGRHCESCRIQDFQIQMLNGNLQSKQSALKAPRLNQGDRVIVVSPSSPPDPKNVEYGVKLLESWGLKVELGAHVFDCYGHYLAGKDRDRLADLNSALRDPDVRAVFTTRGGKGAYRIAHALDFAMCRQDPKPLIGYSDITFLHLALWNACRLVGFHGPYVGWDRHYYGRDAANLLRRALMEPEPIVIHQDPRELTSQVVIEGSASGILVGGNLRCIGKAVGWACPSFAGAILFIEAIDTYIGEIDATLTQLQRSGCLDGVKGVAVGQFIRSAEPRRGKWSAIDVLYDRLSELRVPVLGGLPVGHGPNPLSFPLGTMATLETGTRMLTIEPGVT

Samples

Sample ID Description Type Environment
1 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
2 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
3 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
4 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
5 2643221688 Rhizobium sp. Root482 Isolate Unclassified
6 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
7 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
8 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
9 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
10 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
11 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
12 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
13 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
14 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
79 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
91 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
95 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
126 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
129 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
130 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
131 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
132 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
133 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
134 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
135 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
136 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
137 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
138 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
139 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
143 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
144 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
145 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.59
Nodule 5.29
Rhizoplane 0.59
Rhizosphere 62.35
Stem 0
Stem Tuber 0
Unclassified 11.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10086142 3300003323 Bacteria 1989
2 Ga0065165_1005354 3300005262 Bacteria 7282
3 Ga0070683_100446324 3300005329 Bacteria 1234
4 Ga0068869_100123321 3300005334 Unclassified 1984
5 Ga0070660_100001706 3300005339 Bacteria 15058
6 Ga0070669_100202003 3300005353 Unclassified 1564
7 Ga0070667_100094729 3300005367 Bacteria 2573
8 Ga0070663_100306720 3300005455 Unclassified 1272
9 Ga0070681_10003026 3300005458 Bacteria 15589
10 Ga0070684_100001648 3300005535 Bacteria 16191
11 Ga0070684_100097051 3300005535 Bacteria 2628
12 Ga0070697_100097753 3300005536 Unclassified 2436
13 Ga0070665_100043710 3300005548 Bacteria 4501
14 Ga0068859_100032524 3300005617 Bacteria 5239
15 Ga0068863_100283510 3300005841 Bacteria 1605
16 Ga0068863_100529547 3300005841 Bacteria 1162
17 Ga0068860_100017371 3300005843 Bacteria 7010
18 Ga0081455_10024591 3300005937 Bacteria 5574
19 Ga0070717_10136949 3300006028 Bacteria 2109
20 Ga0075365_10000040 3300006038 Bacteria 47942
21 Ga0075365_10030942 3300006038 Bacteria 3432
22 Ga0075363_100046106 3300006048 Unclassified 2312
23 Ga0075364_10011398 3300006051 Bacteria 5401
24 Ga0075364_10027456 3300006051 Bacteria 3636
25 Ga0075367_10001717 3300006178 Bacteria 9594
26 Ga0075367_10064711 3300006178 Unclassified 2188
27 Ga0075366_10021335 3300006195 Bacteria 3765
28 Ga0075366_10027393 3300006195 Bacteria 3343
29 Ga0068871_100151996 3300006358 Bacteria 1975
30 Ga0075429_100459672 3300006880 Bacteria 1115
31 Ga0097620_100032522 3300006931 Bacteria 5239
32 Ga0079104_1001293 3300006946 Bacteria 17262
33 Ga0099794_10073116 3300007265 Bacteria 1682
34 Ga0105240_10000004 3300009093 Bacteria 708156
35 Ga0105242_10003497 3300009176 Bacteria 12206
36 Ga0105237_10000001 3300009545 Bacteria 1009213
37 Ga0105238_10137041 3300009551 Bacteria 2425
38 Ga0105239_10022438 3300010375 Bacteria 6959
39 Ga0157371_10005508 3300013102 Bacteria 10658
40 Ga0157370_10000957 3300013104 Bacteria 36586
41 Ga0157369_10000029 3300013105 Bacteria 206955
42 Ga0157369_10047340 3300013105 Bacteria 4670
43 Ga0157372_10000002 3300013307 Bacteria 687862
44 Ga0157375_10059868 3300013308 Bacteria 3774
45 Ga0163163_10006260 3300014325 Bacteria 10389
46 Ga0157377_10035472 3300014745 Unclassified 2736
47 Ga0157376_10000027 3300014969 Bacteria 204157
48 Ga0157376_10012719 3300014969 Bacteria 6258
49 Ga0157376_10013882 3300014969 Bacteria 6023
50 Ga0209455_1013854 3300025272 Bacteria 1853
51 Ga0209051_1012073 3300025303 Bacteria 4205
52 Ga0207707_10004970 3300025912 Bacteria 11686
53 Ga0207695_10000009 3300025913 Bacteria 1034276
54 Ga0207671_10000003 3300025914 Bacteria 1065461
55 Ga0207657_10019144 3300025919 Bacteria 6509
56 Ga0207681_10231843 3300025923 Unclassified 1433
57 Ga0207694_10088448 3300025924 Bacteria 2442
58 Ga0207686_10012243 3300025934 Bacteria 4713
59 Ga0207689_10201753 3300025942 Unclassified 1642
60 Ga0207661_10407180 3300025944 Bacteria 1234
61 Ga0207658_10071943 3300025986 Bacteria 2620
62 Ga0207641_10118896 3300026088 Bacteria 2355
63 Ga0207641_10494359 3300026088 Bacteria 1187
64 Ga0209281_1001214 3300027111 Bacteria 17407
65 Ga0268264_10016955 3300028381 Bacteria 5962
66 Ga0265338_10000543 3300028800 Bacteria 66162
67 Ga0307509_10038744 3300031507 Bacteria 5198
68 Ga0307516_10007500 3300031730 Bacteria 12548
69 Ga0307415_100171187 3300032126 Bacteria 1694
70 Ga0373951_0002494 3300035091 Bacteria 4633
71 Ga0395898_0365105 3300037466 Unclassified 1377
72 Ga0436365_0813180 3300039437 Bacteria 4893
73 Ga0436365_0938835 3300039437 Unclassified 3701
74 Ga0436363_1524239 3300039450 Unclassified 3683
75 Ga0436362_0693005 3300039453 Bacteria 2569
76 Ga0436362_1130258 3300039453 Bacteria 1161
77 Ga0439466_0034625 3300041411 Bacteria 1712
78 Ga0451853_1912144 3300041512 Bacteria 1123
79 Ga0439456_007639 3300042013 Unclassified 2223
80 Ga0466972_0076698 3300044658 Bacteria 1592
81 Ga0466965_0000355 3300044683 Bacteria 15546
82 Ga0495638_0000061 3300046460 Bacteria 188551
83 Ga0495580_0001009 3300046472 Bacteria 24762
84 Ga0495597_0068317 3300046542 Bacteria 1536
85 Ga0495667_0000656 3300046559 Bacteria 22105
86 Ga0495625_0051091 3300046660 Bacteria 2965
87 Ga0495657_0008824 3300046675 Bacteria 7676
88 Ga0495604_0040474 3300047317 Bacteria 3659
89 Ga0495684_0232051 3300047471 Bacteria 1349
90 Ga0495686_0000613 3300047472 Bacteria 49253
91 Ga0495686_0006833 3300047472 Bacteria 8654
92 Ga0496114_0064364 3300048917 Bacteria 3071
93 Ga0496122_0001424 3300048925 Bacteria 38740
94 Ga0496122_0017716 3300048925 Bacteria 6633
95 Ga0496123_0001147 3300048926 Bacteria 39513
96 Ga0496123_0047479 3300048926 Bacteria 2900
97 Ga0496124_0001644 3300048927 Bacteria 32013
98 Ga0496124_0017128 3300048927 Bacteria 6848
99 Ga0496126_0071418 3300048929 Bacteria 3090
100 Ga0501033_0100095 3300049570 Bacteria 2116
101 Ga0501034_0137143 3300049571 Unclassified 2427
102 Ga0501036_0006340 3300049572 Bacteria 9600
103 Ga0501039_0178897 3300049575 Bacteria 1668
104 Ga0501041_0262332 3300049577 Bacteria 1086
105 Ga0501042_0082413 3300049578 Bacteria 2306
106 Ga0501043_0088292 3300049579 Bacteria 2436
107 Ga0501043_0238321 3300049579 Bacteria 1404
108 Ga0501046_0091044 3300049580 Bacteria 2346
109 Ga0501047_0036974 3300049581 Bacteria 4719
110 Ga0501047_0091184 3300049581 Unclassified 2925
111 Ga0501048_0115086 3300049582 Bacteria 1900
112 Ga0501067_0031103 3300049583 Bacteria 2962
113 Ga0501070_0066541 3300049586 Unclassified 2984
114 Ga0501072_0024264 3300049588 Bacteria 4716
115 Ga0501073_0046056 3300049589 Unclassified 3069
116 Ga0501074_0241834 3300049590 Bacteria 1284
117 Ga0501075_0174593 3300049591 Bacteria 1640
118 Ga0501076_0354877 3300049592 Bacteria 1204
119 Ga0501079_0075228 3300049741 Bacteria 2611
120 Ga0501080_0098111 3300049742 Unclassified 2719
121 Ga0501081_0017233 3300049743 Bacteria 4779
122 Ga0501083_0002461 3300049744 Bacteria 12687
123 Ga0501035_0059457 3300049822 Bacteria 3403
124 Ga0501044_0018940 3300049823 Bacteria 7370
125 Ga0501045_0050025 3300049824 Bacteria 3049
126 nmdc:mga03n38_18334_c1 3300050490 Bacteria 2761
127 nmdc:mga00v17_10573_c1 3300050491 Bacteria 5044
128 nmdc:mga00v17_126_c1 3300050491 Bacteria 44492
129 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
130 nmdc:mga0yw44_59078_c1 3300050492 Unclassified 2345
131 nmdc:mga0yw44_7935_c1 3300050492 Bacteria 5259
132 nmdc:mga0k408_154_c5 3300050493 Bacteria 3360
133 nmdc:mga0k408_92_c1 3300050493 Bacteria 42940
134 nmdc:mga06z11_47083_c1 3300050494 Unclassified 2188
135 nmdc:mga06z11_829_c1 3300050494 Bacteria 11309
136 nmdc:mga06r32_352690_c1 3300050510 Bacteria 1456
137 nmdc:mga0sz30_47894_c1 3300050516 Unclassified 1807
138 Ga0500610_0009174 3300053079 Bacteria 4364
139 Ga0500646_0001006 3300053090 Bacteria 7709
140 Ga0500583_0000268 3300053092 Bacteria 18428
141 Ga0500651_0000001 3300053093 Bacteria 529808
142 Ga0500569_000001 3300053109 Bacteria 137852
143 Ga0500594_0000018 3300053118 Bacteria 61549
144 Ga0500618_004388 3300053125 Bacteria 4533
145 Ga0500618_005039 3300053125 Bacteria 4078
146 Ga0500642_0016221 3300053130 Bacteria 2823
147 Ga0500588_0000027 3300053146 Bacteria 35097
148 Ga0500589_000007 3300053147 Bacteria 145453
149 Ga0500636_0000011 3300053177 Bacteria 140769
150 Ga0501084_0485373 3300054114 Unclassified 1044
151 Ga0501082_0036185 3300060353 Bacteria 4253
152 Ga0501082_0128050 3300060353 Unclassified 2202
153 Ga0530510_0151557 3300061734 Bacteria 1712

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0091184 Ga0501047_0091184_1233_2069 262
2 3300049586 Ga0501070_0066541 Ga0501070_0066541_153_989 262
3 3300046660 Ga0495625_0051091 Ga0495625_0051091_1130_2074 265
4 3300013105 Ga0157369_10047340 Ga0157369_100473403 268
5 3300048917 Ga0496114_0064364 Ga0496114_0064364_1667_2488 269
6 3300006028 Ga0070717_10136949 Ga0070717_101369492 270
7 3300037466 Ga0395898_0365105 Ga0395898_0365105_160_984 270
8 3300039437 Ga0436365_0938835 Ga0436365_0938835_1225_2049 270
9 3300006946 Ga0079104_1001293 Ga0079104_10012932 271
10 3300027111 Ga0209281_1001214 Ga0209281_10012142 271
11 iso_pu_bacteria 2919408235 2919410257 271
12 3300050493 nmdc:mga0k408_92_c1 nmdc:mga0k408_92_c1_9599_10432 274
13 3300050494 nmdc:mga06z11_829_c1 nmdc:mga06z11_829_c1_5814_6647 274
14 3300014325 Ga0163163_10006260 Ga0163163_1000626011 276
15 3300039453 Ga0436362_1130258 Ga0436362_1130258_259_1101 276
16 3300041512 Ga0451853_1912144 Ga0451853_1912144_107_949 276
17 3300046559 Ga0495667_0000656 Ga0495667_0000656_10261_11103 276
18 3300046675 Ga0495657_0008824 Ga0495657_0008824_1387_2229 276
19 3300047471 Ga0495684_0232051 Ga0495684_0232051_143_985 276
20 3300047317 Ga0495604_0040474 Ga0495604_0040474_1178_2053 277
21 3300053079 Ga0500610_0009174 Ga0500610_0009174_2737_3681 283
22 3300053092 Ga0500583_0000268 Ga0500583_0000268_15346_16290 283
23 3300053147 Ga0500589_000007 Ga0500589_000007_142371_143315 283
24 iso_pu_bacteria 2675903058 2676478585 283
25 3300049570 Ga0501033_0100095 Ga0501033_0100095_722_1594 285
26 3300049575 Ga0501039_0178897 Ga0501039_0178897_329_1201 285
27 3300049577 Ga0501041_0262332 Ga0501041_0262332_97_969 285
28 3300049578 Ga0501042_0082413 Ga0501042_0082413_703_1575 285
29 3300049579 Ga0501043_0238321 Ga0501043_0238321_451_1323 285
30 3300049580 Ga0501046_0091044 Ga0501046_0091044_413_1285 285
31 3300049582 Ga0501048_0115086 Ga0501048_0115086_526_1398 285
32 3300049590 Ga0501074_0241834 Ga0501074_0241834_390_1262 285
33 3300049591 Ga0501075_0174593 Ga0501075_0174593_31_903 285
34 3300049592 Ga0501076_0354877 Ga0501076_0354877_218_1090 285
35 3300049741 Ga0501079_0075228 Ga0501079_0075228_1207_2079 285
36 3300049743 Ga0501081_0017233 Ga0501081_0017233_694_1566 285
37 3300049824 Ga0501045_0050025 Ga0501045_0050025_910_1782 285
38 3300060353 Ga0501082_0036185 Ga0501082_0036185_2344_3228 285
39 3300061734 Ga0530510_0151557 Ga0530510_0151557_646_1518 285
40 3300053130 Ga0500642_0016221 Ga0500642_0016221_1196_2140 286
41 3300005458 Ga0070681_10003026 Ga0070681_1000302610 287
42 3300025912 Ga0207707_10004970 Ga0207707_100049709 287
43 3300039437 Ga0436365_0813180 Ga0436365_0813180_1282_2157 287
44 3300049571 Ga0501034_0137143 Ga0501034_0137143_1015_1932 289
45 3300049583 Ga0501067_0031103 Ga0501067_0031103_1740_2657 289
46 3300049588 Ga0501072_0024264 Ga0501072_0024264_2640_3557 289
47 3300049589 Ga0501073_0046056 Ga0501073_0046056_976_1893 289
48 3300049742 Ga0501080_0098111 Ga0501080_0098111_1101_2018 289
49 3300049744 Ga0501083_0002461 Ga0501083_0002461_7034_7951 289
50 3300054114 Ga0501084_0485373 Ga0501084_0485373_104_1021 289
51 3300060353 Ga0501082_0128050 Ga0501082_0128050_432_1349 289
52 3300005937 Ga0081455_10024591 Ga0081455_100245916 290
53 3300031507 Ga0307509_10038744 Ga0307509_100387446 290
54 3300049572 Ga0501036_0006340 Ga0501036_0006340_2538_3458 290
55 3300049579 Ga0501043_0088292 Ga0501043_0088292_968_1888 290
56 3300049581 Ga0501047_0036974 Ga0501047_0036974_481_1401 290
57 3300049822 Ga0501035_0059457 Ga0501035_0059457_2016_2936 290
58 3300049823 Ga0501044_0018940 Ga0501044_0018940_1552_2472 290
59 iso_pu_bacteria 2838029111 2838033344 290
60 iso_pu_bacteria 2842475841 2842479990 290
61 iso_pu_bacteria 2842502639 2842505225 290
62 3300005262 Ga0065165_1005354 Ga0065165_10053543 291
63 3300013308 Ga0157375_10059868 Ga0157375_100598686 296
64 3300014969 Ga0157376_10013882 Ga0157376_100138828 296
65 3300039450 Ga0436363_1524239 Ga0436363_1524239_1788_2723 298
66 3300047472 Ga0495686_0000613 Ga0495686_0000613_24035_24940 298
67 3300050491 nmdc:mga00v17_126_c1 nmdc:mga00v17_126_c1_20653_21552 298
68 3300050492 nmdc:mga0yw44_59078_c1 nmdc:mga0yw44_59078_c1_1208_2107 298
69 3300050516 nmdc:mga0sz30_47894_c1 nmdc:mga0sz30_47894_c1_679_1578 298
70 3300006038 Ga0075365_10030942 Ga0075365_100309422 299
71 3300025303 Ga0209051_1012073 Ga0209051_10120732 299
72 3300039453 Ga0436362_0693005 Ga0436362_0693005_1013_1975 299
73 3300050492 nmdc:mga0yw44_7935_c1 nmdc:mga0yw44_7935_c1_2998_3906 299
74 iso_pu_bacteria 8055617313 8055624918 299
75 3300025272 Ga0209455_1013854 Ga0209455_10138541 300
76 3300048926 Ga0496123_0047479 Ga0496123_0047479_947_1861 300
77 3300050494 nmdc:mga06z11_47083_c1 nmdc:mga06z11_47083_c1_560_1480 300
78 3300048925 Ga0496122_0001424 Ga0496122_0001424_35267_36181 301
79 3300048926 Ga0496123_0001147 Ga0496123_0001147_36040_36954 301
80 3300053125 Ga0500618_005039 Ga0500618_005039_2433_3356 301
81 3300005536 Ga0070697_100097753 Ga0070697_1000977531 302
82 3300007265 Ga0099794_10073116 Ga0099794_100731163 302
83 3300014969 Ga0157376_10012719 Ga0157376_100127197 302
84 3300046472 Ga0495580_0001009 Ga0495580_0001009_17906_18826 302
85 3300048927 Ga0496124_0017128 Ga0496124_0017128_3332_4249 302
86 iso_pu_bacteria 2513237159 2513997817 302
87 iso_pu_bacteria 2643221634 2644191787 302
88 iso_pu_bacteria 2842521101 2842522920 302
89 iso_pu_bacteria 2868088558 2868095154 302
90 3300005334 Ga0068869_100123321 Ga0068869_1001233212 303
91 3300005353 Ga0070669_100202003 Ga0070669_1002020031 303
92 3300005367 Ga0070667_100094729 Ga0070667_1000947291 303
93 3300005617 Ga0068859_100032524 Ga0068859_1000325242 303
94 3300005841 Ga0068863_100529547 Ga0068863_1005295471 303
95 3300005843 Ga0068860_100017371 Ga0068860_1000173712 303
96 3300006931 Ga0097620_100032522 Ga0097620_1000325222 303
97 3300025923 Ga0207681_10231843 Ga0207681_102318432 303
98 3300025942 Ga0207689_10201753 Ga0207689_102017532 303
99 3300025986 Ga0207658_10071943 Ga0207658_100719431 303
100 3300026088 Ga0207641_10494359 Ga0207641_104943592 303
101 3300028381 Ga0268264_10016955 Ga0268264_100169552 303
102 3300047472 Ga0495686_0006833 Ga0495686_0006833_6642_7583 303
103 3300048925 Ga0496122_0017716 Ga0496122_0017716_2417_3427 303
104 3300050490 nmdc:mga03n38_18334_c1 nmdc:mga03n38_18334_c1_212_1126 303
105 3300053125 Ga0500618_004388 Ga0500618_004388_2815_3744 303
106 3300053177 Ga0500636_0000011 Ga0500636_0000011_2525_3451 303
107 iso_pu_bacteria 2582581306 2585270371 303
108 iso_pu_bacteria 2582581865 2585391457 303
109 iso_pu_bacteria 2643221688 2644496026 303
110 3300005548 Ga0070665_100043710 Ga0070665_1000437102 304
111 3300006880 Ga0075429_100459672 Ga0075429_1004596721 304
112 3300009176 Ga0105242_10003497 Ga0105242_1000349711 304
113 3300009551 Ga0105238_10137041 Ga0105238_101370412 304
114 3300025924 Ga0207694_10088448 Ga0207694_100884483 304
115 3300025934 Ga0207686_10012243 Ga0207686_100122436 304
116 3300032126 Ga0307415_100171187 Ga0307415_1001711872 304
117 3300041411 Ga0439466_0034625 Ga0439466_0034625_628_1584 304
118 3300048927 Ga0496124_0001644 Ga0496124_0001644_9598_10518 304
119 3300050510 nmdc:mga06r32_352690_c1 nmdc:mga06r32_352690_c1_313_1242 304
120 iso_pu_bacteria 3005416602 3005418922 306
121 iso_pu_bacteria 8005484373 8005488937 306
122 iso_pu_bacteria 8046767195 8046772342 306
123 3300006051 Ga0075364_10027456 Ga0075364_100274564 307
124 3300014745 Ga0157377_10035472 Ga0157377_100354723 307
125 3300028800 Ga0265338_10000543 Ga0265338_1000054376 307
126 3300031730 Ga0307516_10007500 Ga0307516_100075004 307
127 3300005841 Ga0068863_100283510 Ga0068863_1002835102 308
128 3300006178 Ga0075367_10064711 Ga0075367_100647112 308
129 3300006195 Ga0075366_10027393 Ga0075366_100273933 308
130 3300006358 Ga0068871_100151996 Ga0068871_1001519963 308
131 3300013102 Ga0157371_10005508 Ga0157371_100055089 308
132 3300026088 Ga0207641_10118896 Ga0207641_101188961 308
133 3300048929 Ga0496126_0071418 Ga0496126_0071418_56_1000 308
134 3300050493 nmdc:mga0k408_154_c5 nmdc:mga0k408_154_c5_1830_2774 308
135 iso_pu_bacteria 2827628540 2827633457 308
136 3300006178 Ga0075367_10001717 Ga0075367_100017179 309
137 3300006195 Ga0075366_10021335 Ga0075366_100213352 309
138 3300010375 Ga0105239_10022438 Ga0105239_100224385 309
139 3300044658 Ga0466972_0076698 Ga0466972_0076698_22_951 309
140 3300044683 Ga0466965_0000355 Ga0466965_0000355_10877_11806 309
141 3300053093 Ga0500651_0000001 Ga0500651_0000001_335303_336232 309
142 3300053118 Ga0500594_0000018 Ga0500594_0000018_2221_3150 309
143 3300003323 rootH1_10086142 rootH1_100861422 310
144 3300005329 Ga0070683_100446324 Ga0070683_1004463242 310
145 3300005339 Ga0070660_100001706 Ga0070660_1000017063 310
146 3300005455 Ga0070663_100306720 Ga0070663_1003067202 310
147 3300005535 Ga0070684_100001648 Ga0070684_10000164821 310
148 3300005535 Ga0070684_100097051 Ga0070684_1000970513 310
149 3300006038 Ga0075365_10000040 Ga0075365_1000004028 310
150 3300006048 Ga0075363_100046106 Ga0075363_1000461062 310
151 3300006051 Ga0075364_10011398 Ga0075364_100113987 310
152 3300009093 Ga0105240_10000004 Ga0105240_10000004129 310
153 3300009545 Ga0105237_10000001 Ga0105237_10000001505 310
154 3300013104 Ga0157370_10000957 Ga0157370_100009579 310
155 3300013105 Ga0157369_10000029 Ga0157369_10000029131 310
156 3300013307 Ga0157372_10000002 Ga0157372_10000002107 310
157 3300014969 Ga0157376_10000027 Ga0157376_1000002782 310
158 3300025913 Ga0207695_10000009 Ga0207695_10000009508 310
159 3300025914 Ga0207671_10000003 Ga0207671_10000003508 310
160 3300025919 Ga0207657_10019144 Ga0207657_100191443 310
161 3300025944 Ga0207661_10407180 Ga0207661_104071802 310
162 3300035091 Ga0373951_0002494 Ga0373951_0002494_569_1522 310
163 3300042013 Ga0439456_007639 Ga0439456_007639_141_1112 310
164 3300046460 Ga0495638_0000061 Ga0495638_0000061_70893_71843 310
165 3300046542 Ga0495597_0068317 Ga0495597_0068317_435_1385 310
166 3300050491 nmdc:mga00v17_10573_c1 nmdc:mga00v17_10573_c1_3922_4905 310
167 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_558033_558977 310
168 3300053090 Ga0500646_0001006 Ga0500646_0001006_5126_6061 310
169 3300053109 Ga0500569_000001 Ga0500569_000001_70894_71844 310
170 3300053146 Ga0500588_0000027 Ga0500588_0000027_8802_9752 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02016

Peptidase_S66

LD-carboxypeptidase N-terminal domain

45

162

0.94

PF17676

Peptidase_S66C

LD-carboxypeptidase C-terminal domain

210

324

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uuk-assembly1.cif.gz_B crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.8693 18 306
6uuk-assembly1.cif.gz_A crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.8685 19 306
4mi1-assembly1.cif.gz_A crystal structure of the double mutant (s112a, h303a) of b.anthracis mycrocine immunity protein (mccf) with aspartyl sulfamoyl adenylates 0.8656 8 306
3tlz-assembly1.cif.gz_B microcin c7 self immunity protein mccf mutant w186f in complex with adenosine monophosphate 0.8647 8 306
3tyx-assembly1.cif.gz_B crystal structure of the f177s mutant of mycrocine immunity protein (mccf) with amp 0.8642 8 306
ID Description Score Start End Superfamily
1zrsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8999 12 136 3.40.50.10740
af_P76008_161_291_3.50.30.60 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.893 174 297 3.50.30.60
3g23B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8905 15 135 3.40.50.10740
4mjxB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8867 5 155 3.40.50.10740
4h1hB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8791 8 154 3.40.50.10740
ID Description Score Start End GO Terms
AF-A0A151FG36-F1-model_v4 deleted 0.9882 22 310
AF-A0A365UQZ7-F1-model_v4 deleted 0.9874 5 94
AF-A0A151FG36-F1-model_v4 deleted 0.9814 22 310
AF-A0A1W6PZW7-F1-model_v4 Peptidase S66 family LD-carboxypeptidase A domain-containing protein 0.977 105 308 GO:0004180
GO:0006508
GO:0008236
AF-A0A2V5TI54-F1-model_v4 LD-carboxypeptidase N-terminal domain-containing protein 0.9769 6 135

Feature Viewer

pLDDT pTM Quality
96.09 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map