F256071

General Info

Members Datasets Scaffolds Average Seq Length
170 108 340 256

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100131969|Ga0070690_1001319691
Length 283
Sequence VVVRGHVSLVGAGPGDPGLLTRTAVARLRAADLVLYDALIGEGILKYARKAQRFFVGKRAGRHAMSQEVIHALMIRAARRGRKVVRLKGGDPFVFGRGGEEALALQQAGIPYEVVPGITSAVAAPAAAGIPVTHRGVASAFLVVSGHDEETFSSAIHQLQPNGVTVVVLMGLGRAEAIACQLIDRGWSRGTPAAIVADATRPQQQVWRGTLDDLARETADVDGDGPGTLVIGDVVAIGMRIGKKEAIESAASRRSATLFRRRSSYGGPAVALAKAGTVAKVRG

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
99 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
102 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
105 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
106 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.35
Nodule 0
Rhizoplane 3.53
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100131969 3300005330 Bacteria 1688
2 Ga0065712_10129916 3300005290 Bacteria 1559
3 Ga0065712_10171720 3300005290 Bacteria 1235
4 Ga0070658_10063629 3300005327 Bacteria 3008
5 Ga0070676_10005636 3300005328 Bacteria 6668
6 Ga0070670_100019196 3300005331 Bacteria 5861
7 Ga0070670_100402362 3300005331 Bacteria 1209
8 Ga0070660_100009759 3300005339 Bacteria 6765
9 Ga0070689_100092639 3300005340 Bacteria 2384
10 Ga0070691_10023050 3300005341 Bacteria 2890
11 Ga0070669_100005138 3300005353 Bacteria 9464
12 Ga0070669_100027088 3300005353 Bacteria 4125
13 Ga0070669_100071467 3300005353 Bacteria 2567
14 Ga0070671_100004603 3300005355 Bacteria 10936
15 Ga0070688_100046498 3300005365 Bacteria 2688
16 Ga0070667_100013795 3300005367 Bacteria 6681
17 Ga0070701_10004957 3300005438 Bacteria 5451
18 Ga0070705_100004685 3300005440 Bacteria 6660
19 Ga0070700_100046420 3300005441 Bacteria 2683
20 Ga0070694_100055842 3300005444 Bacteria 2679
21 Ga0070662_100126138 3300005457 Bacteria 1968
22 Ga0070662_100165416 3300005457 Bacteria 1733
23 Ga0070681_10054808 3300005458 Bacteria 3973
24 Ga0068867_100041331 3300005459 Bacteria 3369
25 Ga0070698_100134822 3300005471 Bacteria 2423
26 Ga0070699_100206684 3300005518 Bacteria 1747
27 Ga0070699_100561886 3300005518 Bacteria 1039
28 Ga0070679_100078050 3300005530 Bacteria 3301
29 Ga0070697_100071744 3300005536 Bacteria 2841
30 Ga0070697_100090037 3300005536 Bacteria 2535
31 Ga0070672_100043240 3300005543 Bacteria 3473
32 Ga0070672_100197415 3300005543 Bacteria 1682
33 Ga0070686_100027124 3300005544 Bacteria 3465
34 Ga0070695_100003684 3300005545 Bacteria 8927
35 Ga0070696_100026680 3300005546 Bacteria 3930
36 Ga0070696_100039875 3300005546 Bacteria 3243
37 Ga0070704_100005520 3300005549 Bacteria 7374
38 Ga0070704_100207828 3300005549 Bacteria 1584
39 Ga0068855_100053983 3300005563 Bacteria 4726
40 Ga0068864_100027158 3300005618 Bacteria 4831
41 Ga0068864_100701172 3300005618 Bacteria 989
42 Ga0068861_100008739 3300005719 Bacteria 6972
43 Ga0068861_100224179 3300005719 Bacteria 1590
44 Ga0068863_100005825 3300005841 Bacteria 12076
45 Ga0068863_100063264 3300005841 Bacteria 3499
46 Ga0068858_100044607 3300005842 Bacteria 4109
47 Ga0068858_100506474 3300005842 Bacteria 1167
48 Ga0068860_100053699 3300005843 Bacteria 3831
49 Ga0068862_100006907 3300005844 Bacteria 9414
50 Ga0068862_100066668 3300005844 Bacteria 3102
51 Ga0081455_10130194 3300005937 Bacteria 1969
52 Ga0075364_10018763 3300006051 Bacteria 4336
53 Ga0075366_10032191 3300006195 Bacteria 3087
54 Ga0075428_100084833 3300006844 Bacteria 3455
55 Ga0075430_100035894 3300006846 Bacteria 4204
56 Ga0075433_10047624 3300006852 Bacteria 3729
57 Ga0075433_10075786 3300006852 Bacteria 2961
58 Ga0075433_10116984 3300006852 Bacteria 2365
59 Ga0075434_100003857 3300006871 Bacteria 13414
60 Ga0075434_100297314 3300006871 Bacteria 1635
61 Ga0068865_100044308 3300006881 Bacteria 3045
62 Ga0075436_100011940 3300006914 Bacteria 5957
63 Ga0075436_100050052 3300006914 Bacteria 2883
64 Ga0075435_100012488 3300007076 Bacteria 6292
65 Ga0075435_100170116 3300007076 Bacteria 1838
66 Ga0111539_10011270 3300009094 Bacteria 11231
67 Ga0111539_10044838 3300009094 Bacteria 5295
68 Ga0111539_10052101 3300009094 Bacteria 4872
69 Ga0111539_10793676 3300009094 Bacteria 1102
70 Ga0105247_10085091 3300009101 Bacteria 1999
71 Ga0114129_10003382 3300009147 Bacteria 22409
72 Ga0114129_10005300 3300009147 Bacteria 18195
73 Ga0114129_10006309 3300009147 Bacteria 16816
74 Ga0114129_10010686 3300009147 Bacteria 13094
75 Ga0114129_10028732 3300009147 Bacteria 7880
76 Ga0114129_10163199 3300009147 Bacteria 3042
77 Ga0114129_10246033 3300009147 Bacteria 2402
78 Ga0114129_10338336 3300009147 Bacteria 1997
79 Ga0114129_10448204 3300009147 Bacteria 1693
80 Ga0105243_10006156 3300009148 Bacteria 9276
81 Ga0105248_10001596 3300009177 Bacteria 25232
82 Ga0105248_10125592 3300009177 Bacteria 2894
83 Ga0105248_10787824 3300009177 Bacteria 1073
84 Ga0105249_10354409 3300009553 Bacteria 1487
85 Ga0105249_10576081 3300009553 Bacteria 1178
86 Ga0163163_10025555 3300014325 Bacteria 5631
87 Ga0157380_10323615 3300014326 Bacteria 1431
88 Ga0157377_10193147 3300014745 Bacteria 1288
89 Ga0157379_10086961 3300014968 Bacteria 2803
90 Ga0157379_10136472 3300014968 Bacteria 2210
91 Ga0207645_10002374 3300025907 Bacteria 14841
92 Ga0207705_10026206 3300025909 Bacteria 4159
93 Ga0207707_10056957 3300025912 Bacteria 3402
94 Ga0207657_10003226 3300025919 Bacteria 17465
95 Ga0207652_10043378 3300025921 Bacteria 3829
96 Ga0207681_10002032 3300025923 Bacteria 13000
97 Ga0207681_10045674 3300025923 Bacteria 2942
98 Ga0207681_10056784 3300025923 Bacteria 2671
99 Ga0207681_10190245 3300025923 Bacteria 1570
100 Ga0207650_10032471 3300025925 Bacteria 3776
101 Ga0207659_10335899 3300025926 Bacteria 1250
102 Ga0207687_10045700 3300025927 Bacteria 3028
103 Ga0207644_10024661 3300025931 Bacteria 4130
104 Ga0207706_10065950 3300025933 Bacteria 3187
105 Ga0207704_10071260 3300025938 Bacteria 2205
106 Ga0207691_10016356 3300025940 Bacteria 7041
107 Ga0207711_10015438 3300025941 Bacteria 6338
108 Ga0207711_10088565 3300025941 Bacteria 2718
109 Ga0207651_10041620 3300025960 Bacteria 3051
110 Ga0207640_10024500 3300025981 Bacteria 3641
111 Ga0207658_10009322 3300025986 Bacteria 6656
112 Ga0207703_10017473 3300026035 Bacteria 5598
113 Ga0207708_10000797 3300026075 Bacteria 23784
114 Ga0207641_10006013 3300026088 Bacteria 10286
115 Ga0207641_10097354 3300026088 Bacteria 2586
116 Ga0207648_10015271 3300026089 Bacteria 7064
117 Ga0207676_10125959 3300026095 Bacteria 2169
118 Ga0207674_10368102 3300026116 Bacteria 1389
119 Ga0207675_100004440 3300026118 Bacteria 13559
120 Ga0207675_100018144 3300026118 Bacteria 6561
121 Ga0207675_100084292 3300026118 Bacteria 2982
122 Ga0207428_10043555 3300027907 Bacteria 3624
123 Ga0207428_10053439 3300027907 Bacteria 3221
124 Ga0268265_10002939 3300028380 Bacteria 12479
125 Ga0268265_10069513 3300028380 Bacteria 2734
126 Ga0268265_10114700 3300028380 Bacteria 2207
127 Ga0268264_10185757 3300028381 Bacteria 1891
128 Ga0307413_10043945 3300031824 Bacteria 2637
129 Ga0307409_100432931 3300031995 Bacteria 1265
130 Ga0307416_100737659 3300032002 Bacteria 1077
131 Ga0373962_0048370 3300035242 Bacteria 1219
132 Ga0495603_0066137 3300046455 Bacteria 2129
133 Ga0495629_0323059 3300046459 Bacteria 1055
134 Ga0495629_0417302 3300046459 Bacteria 911
135 Ga0495659_0138482 3300046664 Bacteria 970
136 Ga0495658_0030974 3300046683 Bacteria 2909
137 Ga0495669_0079243 3300046684 Bacteria 1506
138 Ga0495600_0402341 3300046809 Bacteria 852
139 Ga0496104_0083685 3300048907 Bacteria 3043
140 Ga0496108_0032302 3300048911 Bacteria 4348
141 Ga0496109_0316296 3300048912 Bacteria 1473
142 Ga0496112_0003371 3300048915 Bacteria 13193
143 Ga0496112_0268710 3300048915 Bacteria 1654
144 Ga0496113_0013498 3300048916 Bacteria 5539
145 nmdc:mga00v17_6565_c1 3300050491 Bacteria 6175
146 nmdc:mga0k408_37602_c1 3300050493 Bacteria 2779
147 nmdc:mga05p37_11684_c1 3300050507 Bacteria 10464
148 nmdc:mga05p37_178368_c1 3300050507 Bacteria 2587
149 nmdc:mga05p37_210761_c1 3300050507 Bacteria 2349
150 nmdc:mga05p37_25739_c1 3300050507 Bacteria 7157
151 nmdc:mga05p37_31325_c1 3300050507 Bacteria 6496
152 nmdc:mga05p37_417671_c1 3300050507 Bacteria 1562
153 nmdc:mga05p37_521604_c1 3300050507 Bacteria 1359
154 nmdc:mga0qj67_28401_c1 3300050509 Bacteria 4342
155 nmdc:mga06r32_47085_c1 3300050510 Bacteria 4117
156 nmdc:mga08y16_129742_c1 3300050511 Bacteria 2622
157 nmdc:mga08y16_20889_c1 3300050511 Bacteria 6914
158 nmdc:mga08y16_254221_c1 3300050511 Unclassified 1815
159 nmdc:mga08y16_5324_c1 3300050511 Bacteria 13460
160 nmdc:mga0n895_434856_c1 3300050512 Bacteria 1326
161 nmdc:mga0n895_571336_c1 3300050512 Bacteria 1135
162 nmdc:mga0rr50_264589_c1 3300050513 Bacteria 1431
163 nmdc:mga08x19_12796_c1 3300050514 Bacteria 5061
164 nmdc:mga08x19_27616_c1 3300050514 Bacteria 3550
165 nmdc:mga0a205_146077_c1 3300050515 Bacteria 2265
166 nmdc:mga0a205_178549_c1 3300050515 Bacteria 2018
167 nmdc:mga0a205_37525_c1 3300050515 Bacteria 4659
168 nmdc:mga0a205_46160_c1 3300050515 Bacteria 4201
169 nmdc:mga0a205_54765_c1 3300050515 Bacteria 3851
170 Ga0495619_0166834 3300053085 Bacteria 1522
171 Ga0070690_100131969
172 Ga0065712_10129916
173 Ga0065712_10171720
174 Ga0070658_10063629
175 Ga0070676_10005636
176 Ga0070670_100019196
177 Ga0070670_100402362
178 Ga0070660_100009759
179 Ga0070689_100092639
180 Ga0070691_10023050
181 Ga0070669_100005138
182 Ga0070669_100027088
183 Ga0070669_100071467
184 Ga0070671_100004603
185 Ga0070688_100046498
186 Ga0070667_100013795
187 Ga0070701_10004957
188 Ga0070705_100004685
189 Ga0070700_100046420
190 Ga0070694_100055842
191 Ga0070662_100126138
192 Ga0070662_100165416
193 Ga0070681_10054808
194 Ga0068867_100041331
195 Ga0070698_100134822
196 Ga0070699_100206684
197 Ga0070699_100561886
198 Ga0070679_100078050
199 Ga0070697_100071744
200 Ga0070697_100090037
201 Ga0070672_100043240
202 Ga0070672_100197415
203 Ga0070686_100027124
204 Ga0070695_100003684
205 Ga0070696_100026680
206 Ga0070696_100039875
207 Ga0070704_100005520
208 Ga0070704_100207828
209 Ga0068855_100053983
210 Ga0068864_100027158
211 Ga0068864_100701172
212 Ga0068861_100008739
213 Ga0068861_100224179
214 Ga0068863_100005825
215 Ga0068863_100063264
216 Ga0068858_100044607
217 Ga0068858_100506474
218 Ga0068860_100053699
219 Ga0068862_100006907
220 Ga0068862_100066668
221 Ga0081455_10130194
222 Ga0075364_10018763
223 Ga0075366_10032191
224 Ga0075428_100084833
225 Ga0075430_100035894
226 Ga0075433_10047624
227 Ga0075433_10075786
228 Ga0075433_10116984
229 Ga0075434_100003857
230 Ga0075434_100297314
231 Ga0068865_100044308
232 Ga0075436_100011940
233 Ga0075436_100050052
234 Ga0075435_100012488
235 Ga0075435_100170116
236 Ga0111539_10011270
237 Ga0111539_10044838
238 Ga0111539_10052101
239 Ga0111539_10793676
240 Ga0105247_10085091
241 Ga0114129_10003382
242 Ga0114129_10005300
243 Ga0114129_10006309
244 Ga0114129_10010686
245 Ga0114129_10028732
246 Ga0114129_10163199
247 Ga0114129_10246033
248 Ga0114129_10338336
249 Ga0114129_10448204
250 Ga0105243_10006156
251 Ga0105248_10001596
252 Ga0105248_10125592
253 Ga0105248_10787824
254 Ga0105249_10354409
255 Ga0105249_10576081
256 Ga0163163_10025555
257 Ga0157380_10323615
258 Ga0157377_10193147
259 Ga0157379_10086961
260 Ga0157379_10136472
261 Ga0207645_10002374
262 Ga0207705_10026206
263 Ga0207707_10056957
264 Ga0207657_10003226
265 Ga0207652_10043378
266 Ga0207681_10002032
267 Ga0207681_10045674
268 Ga0207681_10056784
269 Ga0207681_10190245
270 Ga0207650_10032471
271 Ga0207659_10335899
272 Ga0207687_10045700
273 Ga0207644_10024661
274 Ga0207706_10065950
275 Ga0207704_10071260
276 Ga0207691_10016356
277 Ga0207711_10015438
278 Ga0207711_10088565
279 Ga0207651_10041620
280 Ga0207640_10024500
281 Ga0207658_10009322
282 Ga0207703_10017473
283 Ga0207708_10000797
284 Ga0207641_10006013
285 Ga0207641_10097354
286 Ga0207648_10015271
287 Ga0207676_10125959
288 Ga0207674_10368102
289 Ga0207675_100004440
290 Ga0207675_100018144
291 Ga0207675_100084292
292 Ga0207428_10043555
293 Ga0207428_10053439
294 Ga0268265_10002939
295 Ga0268265_10069513
296 Ga0268265_10114700
297 Ga0268264_10185757
298 Ga0307413_10043945
299 Ga0307409_100432931
300 Ga0307416_100737659
301 Ga0373962_0048370
302 Ga0495603_0066137
303 Ga0495629_0323059
304 Ga0495629_0417302
305 Ga0495659_0138482
306 Ga0495658_0030974
307 Ga0495669_0079243
308 Ga0495600_0402341
309 Ga0496104_0083685
310 Ga0496108_0032302
311 Ga0496109_0316296
312 Ga0496112_0003371
313 Ga0496112_0268710
314 Ga0496113_0013498
315 nmdc:mga00v17_6565_c1
316 nmdc:mga0k408_37602_c1
317 nmdc:mga05p37_11684_c1
318 nmdc:mga05p37_178368_c1
319 nmdc:mga05p37_210761_c1
320 nmdc:mga05p37_25739_c1
321 nmdc:mga05p37_31325_c1
322 nmdc:mga05p37_417671_c1
323 nmdc:mga05p37_521604_c1
324 nmdc:mga0qj67_28401_c1
325 nmdc:mga06r32_47085_c1
326 nmdc:mga08y16_129742_c1
327 nmdc:mga08y16_20889_c1
328 nmdc:mga08y16_254221_c1
329 nmdc:mga08y16_5324_c1
330 nmdc:mga0n895_434856_c1
331 nmdc:mga0n895_571336_c1
332 nmdc:mga0rr50_264589_c1
333 nmdc:mga08x19_12796_c1
334 nmdc:mga08x19_27616_c1
335 nmdc:mga0a205_146077_c1
336 nmdc:mga0a205_178549_c1
337 nmdc:mga0a205_37525_c1
338 nmdc:mga0a205_46160_c1
339 nmdc:mga0a205_54765_c1
340 Ga0495619_0166834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

6

215

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s4d-assembly4.cif.gz_H crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt 0.9269 6 238
1pjs-assembly1.cif.gz_A the co-crystal structure of cysg, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis, in complex with it nad cofactor 0.9266 3 240
6veb-assembly1.cif.gz_B precorrin-2-bound s128a s. typhimurium siroheme synthase 0.9246 5 240
1v9a-assembly1.cif.gz_A crystal structure of uroporphyrin-iii c-methyl transferase from thermus thermophilus complexed with s-adenyl homocysteine 0.9223 5 237
6p5x-assembly1.cif.gz_B sirohydrochlorin-bound s. typhimurium siroheme synthase 0.9208 4 240
ID Description Score Start End Superfamily
af_A0A0R0IWM0_102_225_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9711 1 119 3.40.1010.10
1pjsA04 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9569 4 119 3.40.1010.10
1pjsA04 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9401 4 119 3.40.1010.10
1s4dE01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9279 1 118 3.40.1010.10
af_Q2FVM0_1_122_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9276 3 119 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A526YRB0-F1-model_v4 Uroporphyrin-III methyltransferase 0.983 6 117 GO:0004851
GO:0019354
GO:0032259
AF-A0A3D1Q5R3-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9775 3 123 GO:0004851
GO:0019354
GO:0032259
AF-A0A1R3L513-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9732 5 117 GO:0004851
GO:0019354
GO:0032259
AF-A0A7X8K0F3-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9718 4 135 GO:0004851
GO:0019354
GO:0032259
AF-A0A534NYM4-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9713 4 188 GO:0004851
GO:0019354
GO:0032259

Map