F254802

General Info

Members Datasets Scaffolds Average Seq Length
169 129 338 249

Family's Representative Sequence

Representative Sequence 3300020082|Ga0206353_10669982|Ga0206353_106699823
Length 259
Sequence MMNDAVEVEHLRVVRGGRTVLPDLSVRIPTGQVVGLLGPSGSGKSTLIRAIVGVQVVESGRVTVLGQPAGSVGLRHRVGYVTQSPSVYDDLTVRANVRYFASILGVGLAKADEAIEAVDLTSHADAMVRNLSGGQRSRVSLAAALVGDPDLLVLDEPTVGLDPVLRRDLWNLFNRLAHEGGRSLLVSSHVMDEASRCDRLLLLREGRILADQTLADLLSSTGTQDAESAFLALIDRAAEEATRCIPTAPSSPPAGSSPS

Samples

Sample ID Description Type Environment
1 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
31 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
35 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
42 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
45 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
46 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
47 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
50 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
51 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
52 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
53 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
54 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
55 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
56 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
57 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
58 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
59 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
60 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
65 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
66 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
67 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
68 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
69 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
70 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
71 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
72 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
73 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
74 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
75 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
76 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
77 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
78 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
79 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
83 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
84 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
85 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
86 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
104 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
112 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
113 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
114 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
117 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
118 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
119 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
120 2643221572 Leifsonia sp. Root60 Isolate Unclassified
121 2643221616 Leifsonia sp. Root227 Isolate Unclassified
122 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
123 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
124 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
125 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
126 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
127 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
128 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
129 2928153084 Leifsonia sp. 563 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.35
Metatranscriptomes 2.96
Isolates 7.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.75
Nodule 0
Rhizoplane 12.43
Rhizosphere 56.8
Stem 0
Stem Tuber 0.59
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206353_10669982 3300020082 Bacteria 1973
2 JGI25164J39214_1000636 3300002772 Bacteria 14537
3 JGI25165J46597_1000004 3300003214 Bacteria 667510
4 Ga0006562J51391_1033405 3300003578 Bacteria 3372
5 Ga0006562J51391_1033408 3300003578 Bacteria 5710
6 Ga0055539_1000005 3300003752 Bacteria 609598
7 Ga0055533_1000001 3300003756 Bacteria 1863437
8 Ga0055525_1000121 3300003759 Bacteria 119321
9 Ga0055527_1000001 3300003760 Bacteria 850044
10 Ga0055529_1000019 3300003763 Bacteria 332786
11 Ga0055541_1001208 3300003841 Bacteria 5740
12 Ga0070658_10045274 3300005327 Bacteria 3558
13 Ga0070682_100157533 3300005337 Bacteria 1565
14 Ga0070661_100085252 3300005344 Bacteria 2334
15 Ga0070714_100205349 3300005435 Bacteria 1804
16 Ga0068859_100021825 3300005617 Bacteria 6421
17 Ga0075363_100124909 3300006048 Bacteria 1440
18 Ga0075370_10050825 3300006353 Bacteria 2352
19 Ga0075428_100005967 3300006844 Bacteria 13529
20 Ga0075431_100074350 3300006847 Bacteria 3506
21 Ga0105238_10320996 3300009551 Bacteria 1535
22 Ga0105246_10607493 3300011119 Bacteria 946
23 Ga0157369_10007822 3300013105 Bacteria 12303
24 Ga0157369_10087721 3300013105 Bacteria 3322
25 Ga0157369_10315692 3300013105 Bacteria 1625
26 Ga0157369_10315769 3300013105 Bacteria 1625
27 Ga0206354_11400302 3300020081 Bacteria 2424
28 Ga0206353_10990915 3300020082 Bacteria 4442
29 Ga0209566_100065 3300025225 Bacteria 190999
30 Ga0209674_100001 3300025226 Bacteria 4013750
31 Ga0209672_100006 3300025228 Bacteria 1004497
32 Ga0209147_100393 3300025229 Bacteria 29982
33 Ga0209563_100001 3300025230 Bacteria 4013775
34 Ga0209563_100239 3300025230 Bacteria 26445
35 Ga0207427_100010 3300025231 Bacteria 648610
36 Ga0209437_100796 3300025233 Bacteria 14577
37 Ga0209258_100959 3300025242 Bacteria 13693
38 Ga0209677_100001 3300025253 Bacteria 4013787
39 Ga0209677_100536 3300025253 Bacteria 21079
40 Ga0209148_1000015 3300025254 Bacteria 850103
41 Ga0209233_1000001 3300025261 Bacteria 2992747
42 Ga0209455_1000013 3300025272 Bacteria 850103
43 Ga0209455_1002160 3300025272 Bacteria 7796
44 Ga0209051_1057435 3300025303 Bacteria 1247
45 Ga0207657_10354471 3300025919 Bacteria 1157
46 Ga0207664_10330731 3300025929 Bacteria 1346
47 Ga0207661_10409361 3300025944 Bacteria 1231
48 Ga0207674_10020196 3300026116 Bacteria 7203
49 Ga0307517_10092322 3300028786 Bacteria 2464
50 Ga0307518_10143847 3300031838 Bacteria 1659
51 Ga0307410_10329423 3300031852 Bacteria 1214
52 Ga0307409_100889966 3300031995 Bacteria 903
53 Ga0307415_100099676 3300032126 Bacteria 2127
54 Ga0307507_10000005 3300033179 Bacteria 281494
55 Ga0395900_0005250 3300037418 Bacteria 13588
56 Ga0395900_0041311 3300037418 Bacteria 4755
57 Ga0395898_0000015 3300037466 Bacteria 439819
58 Ga0436362_1208396 3300039453 Bacteria 1177
59 Ga0439436_0033006 3300041404 Bacteria 1500
60 Ga0439433_0008418 3300041999 Bacteria 2237
61 Ga0439457_026334 3300042014 Bacteria 1287
62 Ga0466972_0027334 3300044658 Bacteria 2823
63 Ga0466972_0039212 3300044658 Bacteria 2312
64 Ga0466965_0042579 3300044683 Bacteria 2240
65 Ga0466966_0064053 3300044684 Bacteria 2316
66 Ga0466961_0059399 3300044693 Bacteria 2432
67 Ga0466961_0259823 3300044693 Bacteria 1065
68 Ga0466964_0019054 3300044706 Bacteria 2637
69 Ga0466971_0047227 3300044719 Bacteria 1935
70 Ga0466968_0032712 3300044735 Bacteria 2164
71 Ga0466968_0069217 3300044735 Bacteria 1534
72 Ga0466970_0302913 3300044765 Bacteria 901
73 Ga0466960_0079242 3300044901 Bacteria 1651
74 Ga0466960_0161919 3300044901 Bacteria 1202
75 Ga0466959_0017123 3300045049 Bacteria 5307
76 Ga0466959_0118873 3300045049 Bacteria 1880
77 Ga0466967_0141592 3300045976 Bacteria 2240
78 Ga0466967_0168916 3300045976 Bacteria 2057
79 Ga0495638_0000551 3300046460 Bacteria 42775
80 Ga0495641_0053955 3300046461 Bacteria 1827
81 Ga0495597_0039058 3300046542 Bacteria 2126
82 Ga0495613_0171411 3300046689 Bacteria 1540
83 Ga0495581_0073321 3300047315 Bacteria 1981
84 Ga0495672_0169265 3300047320 Bacteria 1116
85 Ga0495686_0049942 3300047472 Bacteria 2630
86 Ga0496100_0342032 3300048903 Bacteria 1128
87 Ga0496100_0359280 3300048903 Bacteria 1102
88 Ga0496101_0011461 3300048904 Bacteria 5885
89 Ga0496102_0001151 3300048905 Bacteria 24161
90 Ga0496102_0093936 3300048905 Bacteria 2779
91 Ga0496102_0149437 3300048905 Bacteria 2194
92 Ga0496103_0050851 3300048906 Bacteria 2564
93 Ga0496103_0070284 3300048906 Bacteria 2190
94 Ga0496104_0085858 3300048907 Bacteria 3004
95 Ga0496104_0281826 3300048907 Bacteria 1575
96 Ga0496105_0026490 3300048908 Bacteria 4730
97 Ga0496105_0066805 3300048908 Bacteria 2969
98 Ga0496108_0103738 3300048911 Bacteria 2426
99 Ga0496109_0018757 3300048912 Bacteria 6084
100 Ga0496110_0005329 3300048913 Bacteria 10073
101 Ga0496114_0010923 3300048917 Bacteria 7238
102 Ga0496114_0018369 3300048917 Bacteria 5654
103 Ga0496114_0140913 3300048917 Bacteria 2087
104 Ga0496114_0426702 3300048917 Bacteria 1174
105 Ga0496115_0012553 3300048918 Bacteria 6382
106 Ga0496115_0527437 3300048918 Bacteria 946
107 Ga0496116_0129697 3300048919 Bacteria 1440
108 Ga0496117_0007633 3300048920 Bacteria 10495
109 Ga0496117_0067560 3300048920 Bacteria 2418
110 Ga0496117_0082578 3300048920 Bacteria 2104
111 Ga0496117_0207504 3300048920 Bacteria 1101
112 Ga0496118_0020774 3300048921 Bacteria 5811
113 Ga0496118_0079500 3300048921 Bacteria 2314
114 Ga0496126_0103733 3300048929 Bacteria 2485
115 Ga0501031_0005101 3300049568 Bacteria 8548
116 Ga0501031_0078326 3300049568 Bacteria 2154
117 Ga0501031_0260373 3300049568 Bacteria 1127
118 Ga0501032_0020042 3300049569 Bacteria 4664
119 Ga0501032_0133021 3300049569 Bacteria 1640
120 Ga0501033_0031832 3300049570 Bacteria 3960
121 Ga0501033_0139202 3300049570 Bacteria 1755
122 Ga0501034_0042192 3300049571 Bacteria 4618
123 Ga0501034_0046705 3300049571 Bacteria 4375
124 Ga0501036_0024341 3300049572 Bacteria 5104
125 Ga0501037_0150071 3300049573 Bacteria 1666
126 Ga0501038_0001776 3300049574 Bacteria 20026
127 Ga0501038_0001945 3300049574 Bacteria 19054
128 Ga0501039_0261727 3300049575 Bacteria 1359
129 Ga0501039_0641589 3300049575 Bacteria 832
130 Ga0501042_0281663 3300049578 Bacteria 1201
131 Ga0501043_0195776 3300049579 Bacteria 1570
132 Ga0501046_0042954 3300049580 Bacteria 3601
133 Ga0501047_0002763 3300049581 Bacteria 16671
134 Ga0501048_0154699 3300049582 Bacteria 1622
135 Ga0501067_0028630 3300049583 Bacteria 3088
136 Ga0501067_0113096 3300049583 Bacteria 1510
137 Ga0501070_0000238 3300049586 Bacteria 51576
138 Ga0501072_0115234 3300049588 Bacteria 2140
139 Ga0501075_0422013 3300049591 Bacteria 1017
140 Ga0501076_0133018 3300049592 Bacteria 2018
141 Ga0501076_0171958 3300049592 Bacteria 1766
142 Ga0501081_0333089 3300049743 Bacteria 1117
143 Ga0501083_0013477 3300049744 Bacteria 5714
144 Ga0501035_0029113 3300049822 Bacteria 5037
145 Ga0501035_0214255 3300049822 Bacteria 1647
146 Ga0501044_0011015 3300049823 Bacteria 9812
147 nmdc:mga0qj67_461725_c1 3300050509 Bacteria 1022
148 nmdc:mga06r32_523503_c1 3300050510 Bacteria 1161
149 Ga0500635_0000079 3300053080 Bacteria 63227
150 Ga0495619_0116628 3300053085 Bacteria 1828
151 Ga0500569_000018 3300053109 Bacteria 42775
152 Ga0500568_0000164 3300053139 Bacteria 57135
153 Ga0500588_0001320 3300053146 Bacteria 4665
154 Ga0501084_0202307 3300054114 Bacteria 1676
155 Ga0501084_0770468 3300054114 Bacteria 811
156 Ga0501082_0175262 3300060353 Bacteria 1864
157 2558912728 2558860112 Bacteria 9931328
158 2566997436 2565956761 Bacteria 6601618
159 2643851379 2643221567 Bacteria 4163945
160 2643875894 2643221572 Bacteria 3614809
161 2644096847 2643221616 Bacteria 4066575
162 2644138030 2643221624 Bacteria 4384879
163 2644382949 2643221669 Bacteria 3611286
164 2844842955 2844841374 Bacteria 3917147
165 2884765942 2884763398 Bacteria 4091164
166 2919058936 2919055335 Bacteria 3875751
167 2919449131 2919446982 Bacteria 3994487
168 2919525051 2919523602 Bacteria 3788128
169 2928156748 2928153084 Bacteria 4020257
170 Ga0206353_10669982
171 JGI25164J39214_1000636
172 JGI25165J46597_1000004
173 Ga0006562J51391_1033405
174 Ga0006562J51391_1033408
175 Ga0055539_1000005
176 Ga0055533_1000001
177 Ga0055525_1000121
178 Ga0055527_1000001
179 Ga0055529_1000019
180 Ga0055541_1001208
181 Ga0070658_10045274
182 Ga0070682_100157533
183 Ga0070661_100085252
184 Ga0070714_100205349
185 Ga0068859_100021825
186 Ga0075363_100124909
187 Ga0075370_10050825
188 Ga0075428_100005967
189 Ga0075431_100074350
190 Ga0105238_10320996
191 Ga0105246_10607493
192 Ga0157369_10007822
193 Ga0157369_10087721
194 Ga0157369_10315692
195 Ga0157369_10315769
196 Ga0206354_11400302
197 Ga0206353_10990915
198 Ga0209566_100065
199 Ga0209674_100001
200 Ga0209672_100006
201 Ga0209147_100393
202 Ga0209563_100001
203 Ga0209563_100239
204 Ga0207427_100010
205 Ga0209437_100796
206 Ga0209258_100959
207 Ga0209677_100001
208 Ga0209677_100536
209 Ga0209148_1000015
210 Ga0209233_1000001
211 Ga0209455_1000013
212 Ga0209455_1002160
213 Ga0209051_1057435
214 Ga0207657_10354471
215 Ga0207664_10330731
216 Ga0207661_10409361
217 Ga0207674_10020196
218 Ga0307517_10092322
219 Ga0307518_10143847
220 Ga0307410_10329423
221 Ga0307409_100889966
222 Ga0307415_100099676
223 Ga0307507_10000005
224 Ga0395900_0005250
225 Ga0395900_0041311
226 Ga0395898_0000015
227 Ga0436362_1208396
228 Ga0439436_0033006
229 Ga0439433_0008418
230 Ga0439457_026334
231 Ga0466972_0027334
232 Ga0466972_0039212
233 Ga0466965_0042579
234 Ga0466966_0064053
235 Ga0466961_0059399
236 Ga0466961_0259823
237 Ga0466964_0019054
238 Ga0466971_0047227
239 Ga0466968_0032712
240 Ga0466968_0069217
241 Ga0466970_0302913
242 Ga0466960_0079242
243 Ga0466960_0161919
244 Ga0466959_0017123
245 Ga0466959_0118873
246 Ga0466967_0141592
247 Ga0466967_0168916
248 Ga0495638_0000551
249 Ga0495641_0053955
250 Ga0495597_0039058
251 Ga0495613_0171411
252 Ga0495581_0073321
253 Ga0495672_0169265
254 Ga0495686_0049942
255 Ga0496100_0342032
256 Ga0496100_0359280
257 Ga0496101_0011461
258 Ga0496102_0001151
259 Ga0496102_0093936
260 Ga0496102_0149437
261 Ga0496103_0050851
262 Ga0496103_0070284
263 Ga0496104_0085858
264 Ga0496104_0281826
265 Ga0496105_0026490
266 Ga0496105_0066805
267 Ga0496108_0103738
268 Ga0496109_0018757
269 Ga0496110_0005329
270 Ga0496114_0010923
271 Ga0496114_0018369
272 Ga0496114_0140913
273 Ga0496114_0426702
274 Ga0496115_0012553
275 Ga0496115_0527437
276 Ga0496116_0129697
277 Ga0496117_0007633
278 Ga0496117_0067560
279 Ga0496117_0082578
280 Ga0496117_0207504
281 Ga0496118_0020774
282 Ga0496118_0079500
283 Ga0496126_0103733
284 Ga0501031_0005101
285 Ga0501031_0078326
286 Ga0501031_0260373
287 Ga0501032_0020042
288 Ga0501032_0133021
289 Ga0501033_0031832
290 Ga0501033_0139202
291 Ga0501034_0042192
292 Ga0501034_0046705
293 Ga0501036_0024341
294 Ga0501037_0150071
295 Ga0501038_0001776
296 Ga0501038_0001945
297 Ga0501039_0261727
298 Ga0501039_0641589
299 Ga0501042_0281663
300 Ga0501043_0195776
301 Ga0501046_0042954
302 Ga0501047_0002763
303 Ga0501048_0154699
304 Ga0501067_0028630
305 Ga0501067_0113096
306 Ga0501070_0000238
307 Ga0501072_0115234
308 Ga0501075_0422013
309 Ga0501076_0133018
310 Ga0501076_0171958
311 Ga0501081_0333089
312 Ga0501083_0013477
313 Ga0501035_0029113
314 Ga0501035_0214255
315 Ga0501044_0011015
316 nmdc:mga0qj67_461725_c1
317 nmdc:mga06r32_523503_c1
318 Ga0500635_0000079
319 Ga0495619_0116628
320 Ga0500569_000018
321 Ga0500568_0000164
322 Ga0500588_0001320
323 Ga0501084_0202307
324 Ga0501084_0770468
325 Ga0501082_0175262
326 2558912728
327 2566997436
328 2643851379
329 2643875894
330 2644096847
331 2644138030
332 2644382949
333 2844842955
334 2884765942
335 2919058936
336 2919449131
337 2919525051
338 2928156748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

159

0.96

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

119

190

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9495 26 213
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9482 26 213
7osf-assembly1.cif.gz_B abc transporter complex nosdfyl, r-domain 1 0.9197 25 213
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9155 26 217
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9137 26 213
ID Description Score Start End Superfamily
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9702 26 216 3.40.50.300
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9325 23 216 3.40.50.300
af_P0A9U1_1_234_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9288 26 217 3.40.50.300
af_Q9VVJ9_503_747_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9254 26 200 3.40.50.300
af_Q0E8Q7_447_706_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9247 26 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1X0B0N3-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9759 26 216 GO:0005524
GO:0016887
AF-A0A2W5SP83-F1-model_v4 ABC transporter ATP-binding protein 0.9552 26 215 GO:0005524
GO:0016887
AF-A0A7C6LAL1-F1-model_v4 ABC transporter ATP-binding protein 0.9531 26 215 GO:0005524
GO:0016887
AF-A0A5E4LS33-F1-model_v4 Trehalose/maltose import ATP-binding protein MalK (EC 3.6.3.19) 0.9531 26 213 GO:0005524
GO:0016887
AF-A0A838E5N4-F1-model_v4 ABC transporter ATP-binding protein 0.9529 26 210 GO:0005524
GO:0016887

Map