F254649
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 169 | 122 | 169 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10001386|Ga0105243_100013863 |
| Length | 285 |
| Sequence | MILPIIVETCLLGPMPERAVAPWPEGCTPSGANWVVEATGDALIDLHCHILDAIDDGARDADDSVAMARQAEADGIEAVCATPHIRHDHDVRIEELAGRVAGLNAKLEQELVAVRILQGGEVAETAVEGLSEEELNLLSLGGGGWILLEPAPGPLDDSLLRRVAYLADRGHRTIIAHPERHLSADMFERMAALVGEGALIQATADFFLRENMAAGMLAMAEKGLVHVLSSDAHTVLGGRPVRISPALERLREIEWLAPHLDWIAKTAPHAIVTGDALNPPFAPRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 27 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 29 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 44 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 75 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 76 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 77 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 78 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 79 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 80 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 81 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 108 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 109 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 110 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 111 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 112 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 113 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 114 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 115 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 122 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.41 |
| Metatranscriptomes | 0.59 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.18 |
| Nodule | 0 |
| Rhizoplane | 8.88 |
| Rhizosphere | 89.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10280805 | 3300003320 | Bacteria | 2128 |
| 2 | Ga0070683_100000304 | 3300005329 | Bacteria | 33703 |
| 3 | Ga0070690_100077064 | 3300005330 | Bacteria | 2176 |
| 4 | Ga0070666_10049217 | 3300005335 | Bacteria | 2832 |
| 5 | Ga0070680_100070014 | 3300005336 | Bacteria | 2881 |
| 6 | Ga0070682_100000049 | 3300005337 | Bacteria | 127229 |
| 7 | Ga0068868_100001365 | 3300005338 | Bacteria | 16819 |
| 8 | Ga0070661_100000199 | 3300005344 | Bacteria | 49733 |
| 9 | Ga0070692_10146300 | 3300005345 | Bacteria | 1342 |
| 10 | Ga0070675_100000025 | 3300005354 | Bacteria | 115134 |
| 11 | Ga0070688_100000149 | 3300005365 | Bacteria | 37792 |
| 12 | Ga0070688_100007658 | 3300005365 | Bacteria | 5832 |
| 13 | Ga0070688_100103945 | 3300005365 | Bacteria | 1878 |
| 14 | Ga0070659_100001957 | 3300005366 | Bacteria | 14721 |
| 15 | Ga0070714_100108854 | 3300005435 | Bacteria | 2451 |
| 16 | Ga0070713_100000092 | 3300005436 | Bacteria | 57390 |
| 17 | Ga0070711_100237952 | 3300005439 | Bacteria | 1422 |
| 18 | Ga0070685_10000024 | 3300005466 | Bacteria | 101602 |
| 19 | Ga0070685_10000025 | 3300005466 | Bacteria | 100621 |
| 20 | Ga0070685_10127280 | 3300005466 | Bacteria | 1589 |
| 21 | Ga0070679_100000247 | 3300005530 | Bacteria | 45331 |
| 22 | Ga0070684_100014197 | 3300005535 | Bacteria | 6444 |
| 23 | Ga0070684_100121324 | 3300005535 | Bacteria | 2352 |
| 24 | Ga0070684_100274815 | 3300005535 | Bacteria | 1543 |
| 25 | Ga0070684_100305793 | 3300005535 | Bacteria | 1459 |
| 26 | Ga0068853_100042714 | 3300005539 | Bacteria | 3877 |
| 27 | Ga0070672_100000025 | 3300005543 | Bacteria | 67313 |
| 28 | Ga0070665_100003670 | 3300005548 | Bacteria | 16268 |
| 29 | Ga0070665_100037477 | 3300005548 | Unclassified | 4876 |
| 30 | Ga0070664_100003749 | 3300005564 | Bacteria | 12259 |
| 31 | Ga0068857_100047601 | 3300005577 | Bacteria | 3807 |
| 32 | Ga0068854_100000278 | 3300005578 | Bacteria | 34358 |
| 33 | Ga0068856_100087212 | 3300005614 | Bacteria | 3102 |
| 34 | Ga0068851_10015167 | 3300005834 | Bacteria | 3668 |
| 35 | Ga0070712_100018780 | 3300006175 | Bacteria | 4496 |
| 36 | Ga0068865_100000034 | 3300006881 | Bacteria | 84043 |
| 37 | Ga0105240_10298406 | 3300009093 | Bacteria | 1844 |
| 38 | Ga0105245_10000135 | 3300009098 | Bacteria | 70480 |
| 39 | Ga0105245_10021916 | 3300009098 | Bacteria | 5606 |
| 40 | Ga0105243_10001386 | 3300009148 | Bacteria | 21489 |
| 41 | Ga0105241_10110919 | 3300009174 | Bacteria | 2195 |
| 42 | Ga0105242_10000397 | 3300009176 | Bacteria | 34573 |
| 43 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 44 | Ga0105248_10401303 | 3300009177 | Bacteria | 1544 |
| 45 | Ga0105239_10121563 | 3300010375 | Bacteria | 2900 |
| 46 | Ga0157369_10000020 | 3300013105 | Bacteria | 241679 |
| 47 | Ga0157374_10140326 | 3300013296 | Bacteria | 2346 |
| 48 | Ga0157378_10010088 | 3300013297 | Bacteria | 8235 |
| 49 | Ga0157372_10008018 | 3300013307 | Bacteria | 11233 |
| 50 | Ga0157375_10531758 | 3300013308 | Bacteria | 1338 |
| 51 | Ga0157375_10731503 | 3300013308 | Bacteria | 1142 |
| 52 | Ga0157380_10000037 | 3300014326 | Bacteria | 80856 |
| 53 | Ga0157380_10044520 | 3300014326 | Bacteria | 3479 |
| 54 | Ga0157376_10080756 | 3300014969 | Bacteria | 2790 |
| 55 | Ga0206354_11163127 | 3300020081 | Bacteria | 1196 |
| 56 | Ga0207656_10009377 | 3300025321 | Bacteria | 3636 |
| 57 | Ga0207680_10042342 | 3300025903 | Bacteria | 2663 |
| 58 | Ga0207707_10011149 | 3300025912 | Bacteria | 7820 |
| 59 | Ga0207695_10227784 | 3300025913 | Bacteria | 1769 |
| 60 | Ga0207693_10024303 | 3300025915 | Bacteria | 4810 |
| 61 | Ga0207663_10002676 | 3300025916 | Bacteria | 8589 |
| 62 | Ga0207663_10306565 | 3300025916 | Bacteria | 1188 |
| 63 | Ga0207660_10056781 | 3300025917 | Bacteria | 2802 |
| 64 | Ga0207660_10191491 | 3300025917 | Bacteria | 1593 |
| 65 | Ga0207649_10000009 | 3300025920 | Bacteria | 295544 |
| 66 | Ga0207652_10000323 | 3300025921 | Bacteria | 49536 |
| 67 | Ga0207659_10000033 | 3300025926 | Bacteria | 113729 |
| 68 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 69 | Ga0207687_10012546 | 3300025927 | Bacteria | 5535 |
| 70 | Ga0207700_10000007 | 3300025928 | Bacteria | 345720 |
| 71 | Ga0207700_10057159 | 3300025928 | Bacteria | 2941 |
| 72 | Ga0207690_10007782 | 3300025932 | Bacteria | 6360 |
| 73 | Ga0207686_10000252 | 3300025934 | Bacteria | 40825 |
| 74 | Ga0207709_10122285 | 3300025935 | Bacteria | 1759 |
| 75 | Ga0207704_10000059 | 3300025938 | Bacteria | 76643 |
| 76 | Ga0207691_10000135 | 3300025940 | Bacteria | 67302 |
| 77 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 78 | Ga0207661_10000056 | 3300025944 | Bacteria | 85250 |
| 79 | Ga0207661_10000986 | 3300025944 | Bacteria | 18816 |
| 80 | Ga0207661_10003365 | 3300025944 | Bacteria | 11111 |
| 81 | Ga0207661_10004298 | 3300025944 | Bacteria | 9975 |
| 82 | Ga0207651_10000613 | 3300025960 | Bacteria | 15010 |
| 83 | Ga0207668_10002673 | 3300025972 | Bacteria | 10430 |
| 84 | Ga0207640_10000225 | 3300025981 | Bacteria | 39704 |
| 85 | Ga0207677_10002215 | 3300026023 | Bacteria | 10205 |
| 86 | Ga0207639_10002631 | 3300026041 | Bacteria | 12052 |
| 87 | Ga0207678_10135615 | 3300026067 | Bacteria | 2100 |
| 88 | Ga0207708_10216437 | 3300026075 | Bacteria | 1533 |
| 89 | Ga0207702_10000360 | 3300026078 | Bacteria | 52006 |
| 90 | Ga0207702_10007336 | 3300026078 | Bacteria | 9418 |
| 91 | Ga0207674_10041884 | 3300026116 | Bacteria | 4734 |
| 92 | Ga0207698_10002365 | 3300026142 | Bacteria | 11183 |
| 93 | Ga0268266_10002714 | 3300028379 | Bacteria | 18561 |
| 94 | Ga0268266_10026991 | 3300028379 | Unclassified | 4886 |
| 95 | Ga0307415_100009525 | 3300032126 | Bacteria | 5451 |
| 96 | Ga0373933_0035986 | 3300035724 | Bacteria | 2895 |
| 97 | Ga0373937_0286499 | 3300036401 | Unclassified | 1556 |
| 98 | Ga0466963_0000067 | 3300044694 | Bacteria | 35973 |
| 99 | Ga0466963_0005427 | 3300044694 | Bacteria | 7467 |
| 100 | Ga0466957_0002355 | 3300044842 | Bacteria | 10134 |
| 101 | Ga0466958_0165957 | 3300045836 | Unclassified | 1397 |
| 102 | Ga0466967_0000038 | 3300045976 | Bacteria | 49163 |
| 103 | Ga0495629_0000145 | 3300046459 | Bacteria | 61915 |
| 104 | Ga0495629_0003718 | 3300046459 | Bacteria | 11499 |
| 105 | Ga0495641_0013365 | 3300046461 | Bacteria | 4517 |
| 106 | Ga0495641_0028444 | 3300046461 | Bacteria | 2705 |
| 107 | Ga0495653_0182016 | 3300046463 | Bacteria | 1441 |
| 108 | Ga0495639_0026598 | 3300046475 | Bacteria | 2558 |
| 109 | Ga0495639_0105661 | 3300046475 | Bacteria | 1333 |
| 110 | Ga0495662_0000421 | 3300046476 | Bacteria | 18951 |
| 111 | Ga0495662_0003418 | 3300046476 | Bacteria | 8045 |
| 112 | Ga0495606_0000072 | 3300046507 | Bacteria | 173678 |
| 113 | Ga0495608_0000023 | 3300046511 | Bacteria | 160090 |
| 114 | Ga0495618_0000008 | 3300046514 | Bacteria | 204578 |
| 115 | Ga0495628_0002719 | 3300046516 | Bacteria | 15837 |
| 116 | Ga0495628_0254579 | 3300046516 | Bacteria | 1310 |
| 117 | Ga0495630_0000012 | 3300046517 | Bacteria | 223330 |
| 118 | Ga0495586_0001394 | 3300046535 | Bacteria | 13383 |
| 119 | Ga0495586_0343276 | 3300046535 | Bacteria | 857 |
| 120 | Ga0495667_0000047 | 3300046559 | Bacteria | 117718 |
| 121 | Ga0495588_0000244 | 3300046674 | Bacteria | 45880 |
| 122 | Ga0495657_0000020 | 3300046675 | Bacteria | 160089 |
| 123 | Ga0495623_0303179 | 3300046679 | Bacteria | 882 |
| 124 | Ga0495647_0000017 | 3300046681 | Bacteria | 83387 |
| 125 | Ga0495647_0002092 | 3300046681 | Bacteria | 6246 |
| 126 | Ga0495658_0004064 | 3300046683 | Bacteria | 7206 |
| 127 | Ga0495613_0000124 | 3300046689 | Bacteria | 75971 |
| 128 | Ga0495613_0000251 | 3300046689 | Bacteria | 50730 |
| 129 | Ga0495624_0000354 | 3300046690 | Bacteria | 36299 |
| 130 | Ga0495624_0014464 | 3300046690 | Bacteria | 5354 |
| 131 | Ga0495649_0004779 | 3300046694 | Bacteria | 8775 |
| 132 | Ga0495600_0005687 | 3300046809 | Bacteria | 7532 |
| 133 | Ga0495600_0014766 | 3300046809 | Bacteria | 4925 |
| 134 | Ga0495600_0220241 | 3300046809 | Bacteria | 1214 |
| 135 | Ga0495604_0000106 | 3300047317 | Bacteria | 69765 |
| 136 | Ga0495604_0000126 | 3300047317 | Bacteria | 63992 |
| 137 | Ga0495604_0007745 | 3300047317 | Bacteria | 8505 |
| 138 | Ga0495680_0000183 | 3300047322 | Bacteria | 66401 |
| 139 | Ga0495680_0009007 | 3300047322 | Bacteria | 9017 |
| 140 | Ga0495675_0000506 | 3300047444 | Bacteria | 25254 |
| 141 | Ga0495593_0165763 | 3300047673 | Unclassified | 1114 |
| 142 | Ga0495602_0000142 | 3300048088 | Bacteria | 66941 |
| 143 | Ga0495602_0136465 | 3300048088 | Bacteria | 1948 |
| 144 | Ga0496102_0000115 | 3300048905 | Bacteria | 114224 |
| 145 | Ga0496103_0000008 | 3300048906 | Bacteria | 340474 |
| 146 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 147 | Ga0496108_0000026 | 3300048911 | Bacteria | 172399 |
| 148 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 149 | Ga0496109_0000060 | 3300048912 | Bacteria | 115800 |
| 150 | Ga0496109_0000075 | 3300048912 | Bacteria | 105050 |
| 151 | Ga0496110_0000240 | 3300048913 | Bacteria | 35546 |
| 152 | Ga0496110_0004297 | 3300048913 | Bacteria | 11026 |
| 153 | Ga0496111_0000355 | 3300048914 | Bacteria | 22710 |
| 154 | Ga0496111_0017387 | 3300048914 | Bacteria | 4973 |
| 155 | Ga0496112_0000013 | 3300048915 | Bacteria | 237194 |
| 156 | Ga0496112_0004734 | 3300048915 | Bacteria | 11594 |
| 157 | Ga0496113_0000090 | 3300048916 | Bacteria | 39733 |
| 158 | Ga0496113_0322054 | 3300048916 | Bacteria | 1239 |
| 159 | Ga0501081_0306482 | 3300049743 | Bacteria | 1165 |
| 160 | Ga0495601_0000027 | 3300053077 | Bacteria | 116790 |
| 161 | Ga0495612_0005037 | 3300053078 | Bacteria | 5472 |
| 162 | Ga0495655_0000001 | 3300053083 | Bacteria | 419518 |
| 163 | Ga0495595_0000022 | 3300053084 | Bacteria | 110598 |
| 164 | Ga0495595_0000107 | 3300053084 | Bacteria | 38201 |
| 165 | Ga0495619_0000152 | 3300053085 | Bacteria | 51090 |
| 166 | Ga0495619_0000222 | 3300053085 | Bacteria | 41071 |
| 167 | Ga0495619_0080336 | 3300053085 | Bacteria | 2195 |
| 168 | Ga0500566_0031767 | 3300053094 | Bacteria | 3077 |
| 169 | Ga0500628_000020 | 3300053129 | Bacteria | 81755 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053083 | Ga0495655_0000001 | Ga0495655_0000001_382770_383501 | 230 |
| 2 | 3300053129 | Ga0500628_000020 | Ga0500628_000020_5805_6536 | 230 |
| 3 | 3300048905 | Ga0496102_0000115 | Ga0496102_0000115_6852_7583 | 232 |
| 4 | 3300048906 | Ga0496103_0000008 | Ga0496103_0000008_13877_14608 | 232 |
| 5 | 3300046459 | Ga0495629_0003718 | Ga0495629_0003718_6503_7237 | 237 |
| 6 | 3300053094 | Ga0500566_0031767 | Ga0500566_0031767_90_824 | 237 |
| 7 | 3300003320 | rootH2_10280805 | rootH2_102808053 | 243 |
| 8 | 3300005329 | Ga0070683_100000304 | Ga0070683_10000030419 | 243 |
| 9 | 3300005330 | Ga0070690_100077064 | Ga0070690_1000770642 | 243 |
| 10 | 3300005335 | Ga0070666_10049217 | Ga0070666_100492173 | 243 |
| 11 | 3300005336 | Ga0070680_100070014 | Ga0070680_1000700142 | 243 |
| 12 | 3300005337 | Ga0070682_100000049 | Ga0070682_10000004963 | 243 |
| 13 | 3300005338 | Ga0068868_100001365 | Ga0068868_10000136511 | 243 |
| 14 | 3300005344 | Ga0070661_100000199 | Ga0070661_10000019919 | 243 |
| 15 | 3300005345 | Ga0070692_10146300 | Ga0070692_101463002 | 243 |
| 16 | 3300005354 | Ga0070675_100000025 | Ga0070675_10000002577 | 243 |
| 17 | 3300005365 | Ga0070688_100000149 | Ga0070688_10000014921 | 243 |
| 18 | 3300005365 | Ga0070688_100007658 | Ga0070688_1000076582 | 243 |
| 19 | 3300005365 | Ga0070688_100103945 | Ga0070688_1001039452 | 243 |
| 20 | 3300005366 | Ga0070659_100001957 | Ga0070659_10000195712 | 243 |
| 21 | 3300005435 | Ga0070714_100108854 | Ga0070714_1001088543 | 243 |
| 22 | 3300005436 | Ga0070713_100000092 | Ga0070713_10000009221 | 243 |
| 23 | 3300005439 | Ga0070711_100237952 | Ga0070711_1002379522 | 243 |
| 24 | 3300005466 | Ga0070685_10000024 | Ga0070685_1000002421 | 243 |
| 25 | 3300005466 | Ga0070685_10000025 | Ga0070685_1000002554 | 243 |
| 26 | 3300005466 | Ga0070685_10127280 | Ga0070685_101272802 | 243 |
| 27 | 3300005530 | Ga0070679_100000247 | Ga0070679_1000002472 | 243 |
| 28 | 3300005535 | Ga0070684_100014197 | Ga0070684_1000141972 | 243 |
| 29 | 3300005535 | Ga0070684_100121324 | Ga0070684_1001213242 | 243 |
| 30 | 3300005535 | Ga0070684_100274815 | Ga0070684_1002748151 | 243 |
| 31 | 3300005535 | Ga0070684_100305793 | Ga0070684_1003057931 | 243 |
| 32 | 3300005539 | Ga0068853_100042714 | Ga0068853_1000427145 | 243 |
| 33 | 3300005543 | Ga0070672_100000025 | Ga0070672_10000002529 | 243 |
| 34 | 3300005548 | Ga0070665_100003670 | Ga0070665_10000367019 | 243 |
| 35 | 3300005548 | Ga0070665_100037477 | Ga0070665_1000374772 | 243 |
| 36 | 3300005564 | Ga0070664_100003749 | Ga0070664_1000037494 | 243 |
| 37 | 3300005577 | Ga0068857_100047601 | Ga0068857_1000476015 | 243 |
| 38 | 3300005578 | Ga0068854_100000278 | Ga0068854_10000027830 | 243 |
| 39 | 3300005614 | Ga0068856_100087212 | Ga0068856_1000872124 | 243 |
| 40 | 3300005834 | Ga0068851_10015167 | Ga0068851_100151672 | 243 |
| 41 | 3300006175 | Ga0070712_100018780 | Ga0070712_1000187804 | 243 |
| 42 | 3300006881 | Ga0068865_100000034 | Ga0068865_10000003440 | 243 |
| 43 | 3300009093 | Ga0105240_10298406 | Ga0105240_102984062 | 243 |
| 44 | 3300009098 | Ga0105245_10000135 | Ga0105245_1000013556 | 243 |
| 45 | 3300009098 | Ga0105245_10021916 | Ga0105245_100219164 | 243 |
| 46 | 3300009148 | Ga0105243_10001386 | Ga0105243_100013863 | 243 |
| 47 | 3300009174 | Ga0105241_10110919 | Ga0105241_101109193 | 243 |
| 48 | 3300009176 | Ga0105242_10000397 | Ga0105242_1000039710 | 243 |
| 49 | 3300009177 | Ga0105248_10000008 | Ga0105248_10000008191 | 243 |
| 50 | 3300009177 | Ga0105248_10401303 | Ga0105248_104013032 | 243 |
| 51 | 3300010375 | Ga0105239_10121563 | Ga0105239_101215632 | 243 |
| 52 | 3300013105 | Ga0157369_10000020 | Ga0157369_1000002045 | 243 |
| 53 | 3300013296 | Ga0157374_10140326 | Ga0157374_101403262 | 243 |
| 54 | 3300013297 | Ga0157378_10010088 | Ga0157378_100100889 | 243 |
| 55 | 3300013307 | Ga0157372_10008018 | Ga0157372_1000801811 | 243 |
| 56 | 3300013308 | Ga0157375_10531758 | Ga0157375_105317582 | 243 |
| 57 | 3300013308 | Ga0157375_10731503 | Ga0157375_107315031 | 243 |
| 58 | 3300014326 | Ga0157380_10000037 | Ga0157380_1000003774 | 243 |
| 59 | 3300014326 | Ga0157380_10044520 | Ga0157380_100445204 | 243 |
| 60 | 3300014969 | Ga0157376_10080756 | Ga0157376_100807562 | 243 |
| 61 | 3300020081 | Ga0206354_11163127 | Ga0206354_111631271 | 243 |
| 62 | 3300025321 | Ga0207656_10009377 | Ga0207656_100093774 | 243 |
| 63 | 3300025903 | Ga0207680_10042342 | Ga0207680_100423423 | 243 |
| 64 | 3300025912 | Ga0207707_10011149 | Ga0207707_100111497 | 243 |
| 65 | 3300025913 | Ga0207695_10227784 | Ga0207695_102277842 | 243 |
| 66 | 3300025915 | Ga0207693_10024303 | Ga0207693_100243034 | 243 |
| 67 | 3300025916 | Ga0207663_10002676 | Ga0207663_1000267610 | 243 |
| 68 | 3300025916 | Ga0207663_10306565 | Ga0207663_103065651 | 243 |
| 69 | 3300025917 | Ga0207660_10056781 | Ga0207660_100567812 | 243 |
| 70 | 3300025917 | Ga0207660_10191491 | Ga0207660_101914912 | 243 |
| 71 | 3300025920 | Ga0207649_10000009 | Ga0207649_1000000991 | 243 |
| 72 | 3300025921 | Ga0207652_10000323 | Ga0207652_1000032355 | 243 |
| 73 | 3300025926 | Ga0207659_10000033 | Ga0207659_1000003369 | 243 |
| 74 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007553 | 243 |
| 75 | 3300025927 | Ga0207687_10012546 | Ga0207687_100125464 | 243 |
| 76 | 3300025928 | Ga0207700_10000007 | Ga0207700_1000000740 | 243 |
| 77 | 3300025928 | Ga0207700_10057159 | Ga0207700_100571594 | 243 |
| 78 | 3300025932 | Ga0207690_10007782 | Ga0207690_100077827 | 243 |
| 79 | 3300025934 | Ga0207686_10000252 | Ga0207686_1000025235 | 243 |
| 80 | 3300025935 | Ga0207709_10122285 | Ga0207709_101222853 | 243 |
| 81 | 3300025938 | Ga0207704_10000059 | Ga0207704_1000005940 | 243 |
| 82 | 3300025940 | Ga0207691_10000135 | Ga0207691_1000013547 | 243 |
| 83 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006585 | 243 |
| 84 | 3300025944 | Ga0207661_10000056 | Ga0207661_1000005676 | 243 |
| 85 | 3300025944 | Ga0207661_10000986 | Ga0207661_100009864 | 243 |
| 86 | 3300025944 | Ga0207661_10003365 | Ga0207661_100033653 | 243 |
| 87 | 3300025944 | Ga0207661_10004298 | Ga0207661_100042987 | 243 |
| 88 | 3300025960 | Ga0207651_10000613 | Ga0207651_1000061312 | 243 |
| 89 | 3300025972 | Ga0207668_10002673 | Ga0207668_100026737 | 243 |
| 90 | 3300025981 | Ga0207640_10000225 | Ga0207640_1000022530 | 243 |
| 91 | 3300026023 | Ga0207677_10002215 | Ga0207677_100022153 | 243 |
| 92 | 3300026041 | Ga0207639_10002631 | Ga0207639_100026315 | 243 |
| 93 | 3300026067 | Ga0207678_10135615 | Ga0207678_101356152 | 243 |
| 94 | 3300026075 | Ga0207708_10216437 | Ga0207708_102164372 | 243 |
| 95 | 3300026078 | Ga0207702_10000360 | Ga0207702_100003604 | 243 |
| 96 | 3300026078 | Ga0207702_10007336 | Ga0207702_100073364 | 243 |
| 97 | 3300026116 | Ga0207674_10041884 | Ga0207674_100418845 | 243 |
| 98 | 3300026142 | Ga0207698_10002365 | Ga0207698_100023657 | 243 |
| 99 | 3300028379 | Ga0268266_10002714 | Ga0268266_100027141 | 243 |
| 100 | 3300028379 | Ga0268266_10026991 | Ga0268266_100269916 | 243 |
| 101 | 3300032126 | Ga0307415_100009525 | Ga0307415_1000095251 | 243 |
| 102 | 3300035724 | Ga0373933_0035986 | Ga0373933_0035986_2147_2878 | 243 |
| 103 | 3300036401 | Ga0373937_0286499 | Ga0373937_0286499_526_1257 | 243 |
| 104 | 3300044694 | Ga0466963_0000067 | Ga0466963_0000067_21173_21922 | 243 |
| 105 | 3300044694 | Ga0466963_0005427 | Ga0466963_0005427_3659_4390 | 243 |
| 106 | 3300044842 | Ga0466957_0002355 | Ga0466957_0002355_9184_9915 | 243 |
| 107 | 3300045836 | Ga0466958_0165957 | Ga0466958_0165957_464_1195 | 243 |
| 108 | 3300045976 | Ga0466967_0000038 | Ga0466967_0000038_41505_42236 | 243 |
| 109 | 3300046459 | Ga0495629_0000145 | Ga0495629_0000145_54709_55440 | 243 |
| 110 | 3300046461 | Ga0495641_0013365 | Ga0495641_0013365_3554_4408 | 243 |
| 111 | 3300046461 | Ga0495641_0028444 | Ga0495641_0028444_755_1486 | 243 |
| 112 | 3300046463 | Ga0495653_0182016 | Ga0495653_0182016_88_819 | 243 |
| 113 | 3300046475 | Ga0495639_0026598 | Ga0495639_0026598_1022_1753 | 243 |
| 114 | 3300046475 | Ga0495639_0105661 | Ga0495639_0105661_175_909 | 243 |
| 115 | 3300046476 | Ga0495662_0000421 | Ga0495662_0000421_11726_12457 | 243 |
| 116 | 3300046476 | Ga0495662_0003418 | Ga0495662_0003418_6592_7323 | 243 |
| 117 | 3300046507 | Ga0495606_0000072 | Ga0495606_0000072_117653_118441 | 243 |
| 118 | 3300046511 | Ga0495608_0000023 | Ga0495608_0000023_3987_4718 | 243 |
| 119 | 3300046514 | Ga0495618_0000008 | Ga0495618_0000008_157118_157852 | 243 |
| 120 | 3300046516 | Ga0495628_0002719 | Ga0495628_0002719_303_1037 | 243 |
| 121 | 3300046516 | Ga0495628_0254579 | Ga0495628_0254579_350_1081 | 243 |
| 122 | 3300046517 | Ga0495630_0000012 | Ga0495630_0000012_24976_25830 | 243 |
| 123 | 3300046535 | Ga0495586_0001394 | Ga0495586_0001394_9628_10362 | 243 |
| 124 | 3300046535 | Ga0495586_0343276 | Ga0495586_0343276_108_842 | 243 |
| 125 | 3300046559 | Ga0495667_0000047 | Ga0495667_0000047_99568_100299 | 243 |
| 126 | 3300046674 | Ga0495588_0000244 | Ga0495588_0000244_38495_39226 | 243 |
| 127 | 3300046675 | Ga0495657_0000020 | Ga0495657_0000020_3987_4718 | 243 |
| 128 | 3300046679 | Ga0495623_0303179 | Ga0495623_0303179_24_770 | 243 |
| 129 | 3300046681 | Ga0495647_0000017 | Ga0495647_0000017_12710_13441 | 243 |
| 130 | 3300046681 | Ga0495647_0002092 | Ga0495647_0002092_1235_2089 | 243 |
| 131 | 3300046683 | Ga0495658_0004064 | Ga0495658_0004064_111_842 | 243 |
| 132 | 3300046689 | Ga0495613_0000124 | Ga0495613_0000124_11944_12678 | 243 |
| 133 | 3300046689 | Ga0495613_0000251 | Ga0495613_0000251_42955_43686 | 243 |
| 134 | 3300046690 | Ga0495624_0000354 | Ga0495624_0000354_2666_3397 | 243 |
| 135 | 3300046690 | Ga0495624_0014464 | Ga0495624_0014464_2116_2850 | 243 |
| 136 | 3300046694 | Ga0495649_0004779 | Ga0495649_0004779_1743_2474 | 243 |
| 137 | 3300046809 | Ga0495600_0005687 | Ga0495600_0005687_2782_3516 | 243 |
| 138 | 3300046809 | Ga0495600_0014766 | Ga0495600_0014766_1855_2586 | 243 |
| 139 | 3300046809 | Ga0495600_0220241 | Ga0495600_0220241_179_910 | 243 |
| 140 | 3300047317 | Ga0495604_0000106 | Ga0495604_0000106_18195_18926 | 243 |
| 141 | 3300047317 | Ga0495604_0000126 | Ga0495604_0000126_15413_16144 | 243 |
| 142 | 3300047317 | Ga0495604_0007745 | Ga0495604_0007745_6290_7021 | 243 |
| 143 | 3300047322 | Ga0495680_0000183 | Ga0495680_0000183_53730_54464 | 243 |
| 144 | 3300047322 | Ga0495680_0009007 | Ga0495680_0009007_166_897 | 243 |
| 145 | 3300047444 | Ga0495675_0000506 | Ga0495675_0000506_3969_4700 | 243 |
| 146 | 3300047673 | Ga0495593_0165763 | Ga0495593_0165763_21_752 | 243 |
| 147 | 3300048088 | Ga0495602_0000142 | Ga0495602_0000142_7038_7769 | 243 |
| 148 | 3300048088 | Ga0495602_0136465 | Ga0495602_0136465_303_1034 | 243 |
| 149 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_630219_630950 | 243 |
| 150 | 3300048911 | Ga0496108_0000026 | Ga0496108_0000026_120664_121395 | 243 |
| 151 | 3300048912 | Ga0496109_0000003 | Ga0496109_0000003_304765_305496 | 243 |
| 152 | 3300048912 | Ga0496109_0000060 | Ga0496109_0000060_46856_47587 | 243 |
| 153 | 3300048912 | Ga0496109_0000075 | Ga0496109_0000075_42021_42800 | 243 |
| 154 | 3300048913 | Ga0496110_0000240 | Ga0496110_0000240_28320_29051 | 243 |
| 155 | 3300048913 | Ga0496110_0004297 | Ga0496110_0004297_283_1014 | 243 |
| 156 | 3300048914 | Ga0496111_0000355 | Ga0496111_0000355_203_934 | 243 |
| 157 | 3300048914 | Ga0496111_0017387 | Ga0496111_0017387_2881_3612 | 243 |
| 158 | 3300048915 | Ga0496112_0000013 | Ga0496112_0000013_129651_130382 | 243 |
| 159 | 3300048915 | Ga0496112_0004734 | Ga0496112_0004734_6707_7438 | 243 |
| 160 | 3300048916 | Ga0496113_0000090 | Ga0496113_0000090_24855_25586 | 243 |
| 161 | 3300048916 | Ga0496113_0322054 | Ga0496113_0322054_160_891 | 243 |
| 162 | 3300049743 | Ga0501081_0306482 | Ga0501081_0306482_78_818 | 243 |
| 163 | 3300053077 | Ga0495601_0000027 | Ga0495601_0000027_7021_7752 | 243 |
| 164 | 3300053078 | Ga0495612_0005037 | Ga0495612_0005037_1144_1875 | 243 |
| 165 | 3300053084 | Ga0495595_0000022 | Ga0495595_0000022_105881_106612 | 243 |
| 166 | 3300053084 | Ga0495595_0000107 | Ga0495595_0000107_10922_11653 | 243 |
| 167 | 3300053085 | Ga0495619_0000152 | Ga0495619_0000152_25254_25985 | 243 |
| 168 | 3300053085 | Ga0495619_0000222 | Ga0495619_0000222_14177_14959 | 243 |
| 169 | 3300053085 | Ga0495619_0080336 | Ga0495619_0080336_1224_1955 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wjd-assembly1.cif.gz_A | crystal structure of the tyrosine phosphatase cps4b from steptococcus pneumoniae tigr4. | 0.8733 | 1 | 235 |
| 2wjd-assembly1.cif.gz_A | crystal structure of the tyrosine phosphatase cps4b from steptococcus pneumoniae tigr4. | 0.8434 | 1 | 235 |
| 3qy7-assembly1.cif.gz_A | crystal structures of ywqe from bacillus subtilis and cpsb from streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases | 0.8388 | 1 | 241 |
| 3qy7-assembly1.cif.gz_A | crystal structures of ywqe from bacillus subtilis and cpsb from streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases | 0.8293 | 1 | 241 |
| 4e4r-assembly1.cif.gz_A-2 | eutd phosphotransacetylase from staphylococcus aureus | 0.6235 | 19 | 75 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qy7A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8389 | 1 | 241 | 3.20.20.140 |
| 3qy8A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.834 | 1 | 235 | 3.20.20.140 |
| 3qy7A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8293 | 1 | 241 | 3.20.20.140 |
| af_Q2G1K6_1_254_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8028 | 1 | 243 | 3.20.20.140 |
| af_Q2G1K6_1_254_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7998 | 1 | 243 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537YQ99-F1-model_v4 | protein-tyrosine-phosphatase (EC 3.1.3.48) | 0.9696 | 1 | 243 |
GO:0004726
GO:0030145 GO:0030946 GO:0140793 |
| AF-A0A3C1DM79-F1-model_v4 | protein-tyrosine-phosphatase (EC 3.1.3.48) | 0.9364 | 1 | 80 |
GO:0004726
GO:0030145 GO:0030946 GO:0140793 |
| AF-A0A7W1NI94-F1-model_v4 | deleted | 0.9247 | 11 | 108 |
|
| AF-A0A7V9M7B4-F1-model_v4 | protein-tyrosine-phosphatase (EC 3.1.3.48) | 0.9049 | 1 | 212 |
GO:0004725
GO:0030145 |
| AF-A0A3C1DM79-F1-model_v4 | protein-tyrosine-phosphatase (EC 3.1.3.48) | 0.9044 | 1 | 80 |
GO:0004726
GO:0030145 GO:0030946 GO:0140793 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar