F254649

General Info

Members Datasets Scaffolds Average Seq Length
169 122 169 246

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10001386|Ga0105243_100013863
Length 285
Sequence MILPIIVETCLLGPMPERAVAPWPEGCTPSGANWVVEATGDALIDLHCHILDAIDDGARDADDSVAMARQAEADGIEAVCATPHIRHDHDVRIEELAGRVAGLNAKLEQELVAVRILQGGEVAETAVEGLSEEELNLLSLGGGGWILLEPAPGPLDDSLLRRVAYLADRGHRTIIAHPERHLSADMFERMAALVGEGALIQATADFFLRENMAAGMLAMAEKGLVHVLSSDAHTVLGGRPVRISPALERLREIEWLAPHLDWIAKTAPHAIVTGDALNPPFAPRL

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
96 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
101 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
117 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
118 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
119 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
122 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 8.88
Rhizosphere 89.35
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10280805 3300003320 Bacteria 2128
2 Ga0070683_100000304 3300005329 Bacteria 33703
3 Ga0070690_100077064 3300005330 Bacteria 2176
4 Ga0070666_10049217 3300005335 Bacteria 2832
5 Ga0070680_100070014 3300005336 Bacteria 2881
6 Ga0070682_100000049 3300005337 Bacteria 127229
7 Ga0068868_100001365 3300005338 Bacteria 16819
8 Ga0070661_100000199 3300005344 Bacteria 49733
9 Ga0070692_10146300 3300005345 Bacteria 1342
10 Ga0070675_100000025 3300005354 Bacteria 115134
11 Ga0070688_100000149 3300005365 Bacteria 37792
12 Ga0070688_100007658 3300005365 Bacteria 5832
13 Ga0070688_100103945 3300005365 Bacteria 1878
14 Ga0070659_100001957 3300005366 Bacteria 14721
15 Ga0070714_100108854 3300005435 Bacteria 2451
16 Ga0070713_100000092 3300005436 Bacteria 57390
17 Ga0070711_100237952 3300005439 Bacteria 1422
18 Ga0070685_10000024 3300005466 Bacteria 101602
19 Ga0070685_10000025 3300005466 Bacteria 100621
20 Ga0070685_10127280 3300005466 Bacteria 1589
21 Ga0070679_100000247 3300005530 Bacteria 45331
22 Ga0070684_100014197 3300005535 Bacteria 6444
23 Ga0070684_100121324 3300005535 Bacteria 2352
24 Ga0070684_100274815 3300005535 Bacteria 1543
25 Ga0070684_100305793 3300005535 Bacteria 1459
26 Ga0068853_100042714 3300005539 Bacteria 3877
27 Ga0070672_100000025 3300005543 Bacteria 67313
28 Ga0070665_100003670 3300005548 Bacteria 16268
29 Ga0070665_100037477 3300005548 Unclassified 4876
30 Ga0070664_100003749 3300005564 Bacteria 12259
31 Ga0068857_100047601 3300005577 Bacteria 3807
32 Ga0068854_100000278 3300005578 Bacteria 34358
33 Ga0068856_100087212 3300005614 Bacteria 3102
34 Ga0068851_10015167 3300005834 Bacteria 3668
35 Ga0070712_100018780 3300006175 Bacteria 4496
36 Ga0068865_100000034 3300006881 Bacteria 84043
37 Ga0105240_10298406 3300009093 Bacteria 1844
38 Ga0105245_10000135 3300009098 Bacteria 70480
39 Ga0105245_10021916 3300009098 Bacteria 5606
40 Ga0105243_10001386 3300009148 Bacteria 21489
41 Ga0105241_10110919 3300009174 Bacteria 2195
42 Ga0105242_10000397 3300009176 Bacteria 34573
43 Ga0105248_10000008 3300009177 Bacteria 403910
44 Ga0105248_10401303 3300009177 Bacteria 1544
45 Ga0105239_10121563 3300010375 Bacteria 2900
46 Ga0157369_10000020 3300013105 Bacteria 241679
47 Ga0157374_10140326 3300013296 Bacteria 2346
48 Ga0157378_10010088 3300013297 Bacteria 8235
49 Ga0157372_10008018 3300013307 Bacteria 11233
50 Ga0157375_10531758 3300013308 Bacteria 1338
51 Ga0157375_10731503 3300013308 Bacteria 1142
52 Ga0157380_10000037 3300014326 Bacteria 80856
53 Ga0157380_10044520 3300014326 Bacteria 3479
54 Ga0157376_10080756 3300014969 Bacteria 2790
55 Ga0206354_11163127 3300020081 Bacteria 1196
56 Ga0207656_10009377 3300025321 Bacteria 3636
57 Ga0207680_10042342 3300025903 Bacteria 2663
58 Ga0207707_10011149 3300025912 Bacteria 7820
59 Ga0207695_10227784 3300025913 Bacteria 1769
60 Ga0207693_10024303 3300025915 Bacteria 4810
61 Ga0207663_10002676 3300025916 Bacteria 8589
62 Ga0207663_10306565 3300025916 Bacteria 1188
63 Ga0207660_10056781 3300025917 Bacteria 2802
64 Ga0207660_10191491 3300025917 Bacteria 1593
65 Ga0207649_10000009 3300025920 Bacteria 295544
66 Ga0207652_10000323 3300025921 Bacteria 49536
67 Ga0207659_10000033 3300025926 Bacteria 113729
68 Ga0207687_10000007 3300025927 Bacteria 604185
69 Ga0207687_10012546 3300025927 Bacteria 5535
70 Ga0207700_10000007 3300025928 Bacteria 345720
71 Ga0207700_10057159 3300025928 Bacteria 2941
72 Ga0207690_10007782 3300025932 Bacteria 6360
73 Ga0207686_10000252 3300025934 Bacteria 40825
74 Ga0207709_10122285 3300025935 Bacteria 1759
75 Ga0207704_10000059 3300025938 Bacteria 76643
76 Ga0207691_10000135 3300025940 Bacteria 67302
77 Ga0207711_10000006 3300025941 Bacteria 792692
78 Ga0207661_10000056 3300025944 Bacteria 85250
79 Ga0207661_10000986 3300025944 Bacteria 18816
80 Ga0207661_10003365 3300025944 Bacteria 11111
81 Ga0207661_10004298 3300025944 Bacteria 9975
82 Ga0207651_10000613 3300025960 Bacteria 15010
83 Ga0207668_10002673 3300025972 Bacteria 10430
84 Ga0207640_10000225 3300025981 Bacteria 39704
85 Ga0207677_10002215 3300026023 Bacteria 10205
86 Ga0207639_10002631 3300026041 Bacteria 12052
87 Ga0207678_10135615 3300026067 Bacteria 2100
88 Ga0207708_10216437 3300026075 Bacteria 1533
89 Ga0207702_10000360 3300026078 Bacteria 52006
90 Ga0207702_10007336 3300026078 Bacteria 9418
91 Ga0207674_10041884 3300026116 Bacteria 4734
92 Ga0207698_10002365 3300026142 Bacteria 11183
93 Ga0268266_10002714 3300028379 Bacteria 18561
94 Ga0268266_10026991 3300028379 Unclassified 4886
95 Ga0307415_100009525 3300032126 Bacteria 5451
96 Ga0373933_0035986 3300035724 Bacteria 2895
97 Ga0373937_0286499 3300036401 Unclassified 1556
98 Ga0466963_0000067 3300044694 Bacteria 35973
99 Ga0466963_0005427 3300044694 Bacteria 7467
100 Ga0466957_0002355 3300044842 Bacteria 10134
101 Ga0466958_0165957 3300045836 Unclassified 1397
102 Ga0466967_0000038 3300045976 Bacteria 49163
103 Ga0495629_0000145 3300046459 Bacteria 61915
104 Ga0495629_0003718 3300046459 Bacteria 11499
105 Ga0495641_0013365 3300046461 Bacteria 4517
106 Ga0495641_0028444 3300046461 Bacteria 2705
107 Ga0495653_0182016 3300046463 Bacteria 1441
108 Ga0495639_0026598 3300046475 Bacteria 2558
109 Ga0495639_0105661 3300046475 Bacteria 1333
110 Ga0495662_0000421 3300046476 Bacteria 18951
111 Ga0495662_0003418 3300046476 Bacteria 8045
112 Ga0495606_0000072 3300046507 Bacteria 173678
113 Ga0495608_0000023 3300046511 Bacteria 160090
114 Ga0495618_0000008 3300046514 Bacteria 204578
115 Ga0495628_0002719 3300046516 Bacteria 15837
116 Ga0495628_0254579 3300046516 Bacteria 1310
117 Ga0495630_0000012 3300046517 Bacteria 223330
118 Ga0495586_0001394 3300046535 Bacteria 13383
119 Ga0495586_0343276 3300046535 Bacteria 857
120 Ga0495667_0000047 3300046559 Bacteria 117718
121 Ga0495588_0000244 3300046674 Bacteria 45880
122 Ga0495657_0000020 3300046675 Bacteria 160089
123 Ga0495623_0303179 3300046679 Bacteria 882
124 Ga0495647_0000017 3300046681 Bacteria 83387
125 Ga0495647_0002092 3300046681 Bacteria 6246
126 Ga0495658_0004064 3300046683 Bacteria 7206
127 Ga0495613_0000124 3300046689 Bacteria 75971
128 Ga0495613_0000251 3300046689 Bacteria 50730
129 Ga0495624_0000354 3300046690 Bacteria 36299
130 Ga0495624_0014464 3300046690 Bacteria 5354
131 Ga0495649_0004779 3300046694 Bacteria 8775
132 Ga0495600_0005687 3300046809 Bacteria 7532
133 Ga0495600_0014766 3300046809 Bacteria 4925
134 Ga0495600_0220241 3300046809 Bacteria 1214
135 Ga0495604_0000106 3300047317 Bacteria 69765
136 Ga0495604_0000126 3300047317 Bacteria 63992
137 Ga0495604_0007745 3300047317 Bacteria 8505
138 Ga0495680_0000183 3300047322 Bacteria 66401
139 Ga0495680_0009007 3300047322 Bacteria 9017
140 Ga0495675_0000506 3300047444 Bacteria 25254
141 Ga0495593_0165763 3300047673 Unclassified 1114
142 Ga0495602_0000142 3300048088 Bacteria 66941
143 Ga0495602_0136465 3300048088 Bacteria 1948
144 Ga0496102_0000115 3300048905 Bacteria 114224
145 Ga0496103_0000008 3300048906 Bacteria 340474
146 Ga0496108_0000001 3300048911 Bacteria 919044
147 Ga0496108_0000026 3300048911 Bacteria 172399
148 Ga0496109_0000003 3300048912 Bacteria 420862
149 Ga0496109_0000060 3300048912 Bacteria 115800
150 Ga0496109_0000075 3300048912 Bacteria 105050
151 Ga0496110_0000240 3300048913 Bacteria 35546
152 Ga0496110_0004297 3300048913 Bacteria 11026
153 Ga0496111_0000355 3300048914 Bacteria 22710
154 Ga0496111_0017387 3300048914 Bacteria 4973
155 Ga0496112_0000013 3300048915 Bacteria 237194
156 Ga0496112_0004734 3300048915 Bacteria 11594
157 Ga0496113_0000090 3300048916 Bacteria 39733
158 Ga0496113_0322054 3300048916 Bacteria 1239
159 Ga0501081_0306482 3300049743 Bacteria 1165
160 Ga0495601_0000027 3300053077 Bacteria 116790
161 Ga0495612_0005037 3300053078 Bacteria 5472
162 Ga0495655_0000001 3300053083 Bacteria 419518
163 Ga0495595_0000022 3300053084 Bacteria 110598
164 Ga0495595_0000107 3300053084 Bacteria 38201
165 Ga0495619_0000152 3300053085 Bacteria 51090
166 Ga0495619_0000222 3300053085 Bacteria 41071
167 Ga0495619_0080336 3300053085 Bacteria 2195
168 Ga0500566_0031767 3300053094 Bacteria 3077
169 Ga0500628_000020 3300053129 Bacteria 81755

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053083 Ga0495655_0000001 Ga0495655_0000001_382770_383501 230
2 3300053129 Ga0500628_000020 Ga0500628_000020_5805_6536 230
3 3300048905 Ga0496102_0000115 Ga0496102_0000115_6852_7583 232
4 3300048906 Ga0496103_0000008 Ga0496103_0000008_13877_14608 232
5 3300046459 Ga0495629_0003718 Ga0495629_0003718_6503_7237 237
6 3300053094 Ga0500566_0031767 Ga0500566_0031767_90_824 237
7 3300003320 rootH2_10280805 rootH2_102808053 243
8 3300005329 Ga0070683_100000304 Ga0070683_10000030419 243
9 3300005330 Ga0070690_100077064 Ga0070690_1000770642 243
10 3300005335 Ga0070666_10049217 Ga0070666_100492173 243
11 3300005336 Ga0070680_100070014 Ga0070680_1000700142 243
12 3300005337 Ga0070682_100000049 Ga0070682_10000004963 243
13 3300005338 Ga0068868_100001365 Ga0068868_10000136511 243
14 3300005344 Ga0070661_100000199 Ga0070661_10000019919 243
15 3300005345 Ga0070692_10146300 Ga0070692_101463002 243
16 3300005354 Ga0070675_100000025 Ga0070675_10000002577 243
17 3300005365 Ga0070688_100000149 Ga0070688_10000014921 243
18 3300005365 Ga0070688_100007658 Ga0070688_1000076582 243
19 3300005365 Ga0070688_100103945 Ga0070688_1001039452 243
20 3300005366 Ga0070659_100001957 Ga0070659_10000195712 243
21 3300005435 Ga0070714_100108854 Ga0070714_1001088543 243
22 3300005436 Ga0070713_100000092 Ga0070713_10000009221 243
23 3300005439 Ga0070711_100237952 Ga0070711_1002379522 243
24 3300005466 Ga0070685_10000024 Ga0070685_1000002421 243
25 3300005466 Ga0070685_10000025 Ga0070685_1000002554 243
26 3300005466 Ga0070685_10127280 Ga0070685_101272802 243
27 3300005530 Ga0070679_100000247 Ga0070679_1000002472 243
28 3300005535 Ga0070684_100014197 Ga0070684_1000141972 243
29 3300005535 Ga0070684_100121324 Ga0070684_1001213242 243
30 3300005535 Ga0070684_100274815 Ga0070684_1002748151 243
31 3300005535 Ga0070684_100305793 Ga0070684_1003057931 243
32 3300005539 Ga0068853_100042714 Ga0068853_1000427145 243
33 3300005543 Ga0070672_100000025 Ga0070672_10000002529 243
34 3300005548 Ga0070665_100003670 Ga0070665_10000367019 243
35 3300005548 Ga0070665_100037477 Ga0070665_1000374772 243
36 3300005564 Ga0070664_100003749 Ga0070664_1000037494 243
37 3300005577 Ga0068857_100047601 Ga0068857_1000476015 243
38 3300005578 Ga0068854_100000278 Ga0068854_10000027830 243
39 3300005614 Ga0068856_100087212 Ga0068856_1000872124 243
40 3300005834 Ga0068851_10015167 Ga0068851_100151672 243
41 3300006175 Ga0070712_100018780 Ga0070712_1000187804 243
42 3300006881 Ga0068865_100000034 Ga0068865_10000003440 243
43 3300009093 Ga0105240_10298406 Ga0105240_102984062 243
44 3300009098 Ga0105245_10000135 Ga0105245_1000013556 243
45 3300009098 Ga0105245_10021916 Ga0105245_100219164 243
46 3300009148 Ga0105243_10001386 Ga0105243_100013863 243
47 3300009174 Ga0105241_10110919 Ga0105241_101109193 243
48 3300009176 Ga0105242_10000397 Ga0105242_1000039710 243
49 3300009177 Ga0105248_10000008 Ga0105248_10000008191 243
50 3300009177 Ga0105248_10401303 Ga0105248_104013032 243
51 3300010375 Ga0105239_10121563 Ga0105239_101215632 243
52 3300013105 Ga0157369_10000020 Ga0157369_1000002045 243
53 3300013296 Ga0157374_10140326 Ga0157374_101403262 243
54 3300013297 Ga0157378_10010088 Ga0157378_100100889 243
55 3300013307 Ga0157372_10008018 Ga0157372_1000801811 243
56 3300013308 Ga0157375_10531758 Ga0157375_105317582 243
57 3300013308 Ga0157375_10731503 Ga0157375_107315031 243
58 3300014326 Ga0157380_10000037 Ga0157380_1000003774 243
59 3300014326 Ga0157380_10044520 Ga0157380_100445204 243
60 3300014969 Ga0157376_10080756 Ga0157376_100807562 243
61 3300020081 Ga0206354_11163127 Ga0206354_111631271 243
62 3300025321 Ga0207656_10009377 Ga0207656_100093774 243
63 3300025903 Ga0207680_10042342 Ga0207680_100423423 243
64 3300025912 Ga0207707_10011149 Ga0207707_100111497 243
65 3300025913 Ga0207695_10227784 Ga0207695_102277842 243
66 3300025915 Ga0207693_10024303 Ga0207693_100243034 243
67 3300025916 Ga0207663_10002676 Ga0207663_1000267610 243
68 3300025916 Ga0207663_10306565 Ga0207663_103065651 243
69 3300025917 Ga0207660_10056781 Ga0207660_100567812 243
70 3300025917 Ga0207660_10191491 Ga0207660_101914912 243
71 3300025920 Ga0207649_10000009 Ga0207649_1000000991 243
72 3300025921 Ga0207652_10000323 Ga0207652_1000032355 243
73 3300025926 Ga0207659_10000033 Ga0207659_1000003369 243
74 3300025927 Ga0207687_10000007 Ga0207687_10000007553 243
75 3300025927 Ga0207687_10012546 Ga0207687_100125464 243
76 3300025928 Ga0207700_10000007 Ga0207700_1000000740 243
77 3300025928 Ga0207700_10057159 Ga0207700_100571594 243
78 3300025932 Ga0207690_10007782 Ga0207690_100077827 243
79 3300025934 Ga0207686_10000252 Ga0207686_1000025235 243
80 3300025935 Ga0207709_10122285 Ga0207709_101222853 243
81 3300025938 Ga0207704_10000059 Ga0207704_1000005940 243
82 3300025940 Ga0207691_10000135 Ga0207691_1000013547 243
83 3300025941 Ga0207711_10000006 Ga0207711_10000006585 243
84 3300025944 Ga0207661_10000056 Ga0207661_1000005676 243
85 3300025944 Ga0207661_10000986 Ga0207661_100009864 243
86 3300025944 Ga0207661_10003365 Ga0207661_100033653 243
87 3300025944 Ga0207661_10004298 Ga0207661_100042987 243
88 3300025960 Ga0207651_10000613 Ga0207651_1000061312 243
89 3300025972 Ga0207668_10002673 Ga0207668_100026737 243
90 3300025981 Ga0207640_10000225 Ga0207640_1000022530 243
91 3300026023 Ga0207677_10002215 Ga0207677_100022153 243
92 3300026041 Ga0207639_10002631 Ga0207639_100026315 243
93 3300026067 Ga0207678_10135615 Ga0207678_101356152 243
94 3300026075 Ga0207708_10216437 Ga0207708_102164372 243
95 3300026078 Ga0207702_10000360 Ga0207702_100003604 243
96 3300026078 Ga0207702_10007336 Ga0207702_100073364 243
97 3300026116 Ga0207674_10041884 Ga0207674_100418845 243
98 3300026142 Ga0207698_10002365 Ga0207698_100023657 243
99 3300028379 Ga0268266_10002714 Ga0268266_100027141 243
100 3300028379 Ga0268266_10026991 Ga0268266_100269916 243
101 3300032126 Ga0307415_100009525 Ga0307415_1000095251 243
102 3300035724 Ga0373933_0035986 Ga0373933_0035986_2147_2878 243
103 3300036401 Ga0373937_0286499 Ga0373937_0286499_526_1257 243
104 3300044694 Ga0466963_0000067 Ga0466963_0000067_21173_21922 243
105 3300044694 Ga0466963_0005427 Ga0466963_0005427_3659_4390 243
106 3300044842 Ga0466957_0002355 Ga0466957_0002355_9184_9915 243
107 3300045836 Ga0466958_0165957 Ga0466958_0165957_464_1195 243
108 3300045976 Ga0466967_0000038 Ga0466967_0000038_41505_42236 243
109 3300046459 Ga0495629_0000145 Ga0495629_0000145_54709_55440 243
110 3300046461 Ga0495641_0013365 Ga0495641_0013365_3554_4408 243
111 3300046461 Ga0495641_0028444 Ga0495641_0028444_755_1486 243
112 3300046463 Ga0495653_0182016 Ga0495653_0182016_88_819 243
113 3300046475 Ga0495639_0026598 Ga0495639_0026598_1022_1753 243
114 3300046475 Ga0495639_0105661 Ga0495639_0105661_175_909 243
115 3300046476 Ga0495662_0000421 Ga0495662_0000421_11726_12457 243
116 3300046476 Ga0495662_0003418 Ga0495662_0003418_6592_7323 243
117 3300046507 Ga0495606_0000072 Ga0495606_0000072_117653_118441 243
118 3300046511 Ga0495608_0000023 Ga0495608_0000023_3987_4718 243
119 3300046514 Ga0495618_0000008 Ga0495618_0000008_157118_157852 243
120 3300046516 Ga0495628_0002719 Ga0495628_0002719_303_1037 243
121 3300046516 Ga0495628_0254579 Ga0495628_0254579_350_1081 243
122 3300046517 Ga0495630_0000012 Ga0495630_0000012_24976_25830 243
123 3300046535 Ga0495586_0001394 Ga0495586_0001394_9628_10362 243
124 3300046535 Ga0495586_0343276 Ga0495586_0343276_108_842 243
125 3300046559 Ga0495667_0000047 Ga0495667_0000047_99568_100299 243
126 3300046674 Ga0495588_0000244 Ga0495588_0000244_38495_39226 243
127 3300046675 Ga0495657_0000020 Ga0495657_0000020_3987_4718 243
128 3300046679 Ga0495623_0303179 Ga0495623_0303179_24_770 243
129 3300046681 Ga0495647_0000017 Ga0495647_0000017_12710_13441 243
130 3300046681 Ga0495647_0002092 Ga0495647_0002092_1235_2089 243
131 3300046683 Ga0495658_0004064 Ga0495658_0004064_111_842 243
132 3300046689 Ga0495613_0000124 Ga0495613_0000124_11944_12678 243
133 3300046689 Ga0495613_0000251 Ga0495613_0000251_42955_43686 243
134 3300046690 Ga0495624_0000354 Ga0495624_0000354_2666_3397 243
135 3300046690 Ga0495624_0014464 Ga0495624_0014464_2116_2850 243
136 3300046694 Ga0495649_0004779 Ga0495649_0004779_1743_2474 243
137 3300046809 Ga0495600_0005687 Ga0495600_0005687_2782_3516 243
138 3300046809 Ga0495600_0014766 Ga0495600_0014766_1855_2586 243
139 3300046809 Ga0495600_0220241 Ga0495600_0220241_179_910 243
140 3300047317 Ga0495604_0000106 Ga0495604_0000106_18195_18926 243
141 3300047317 Ga0495604_0000126 Ga0495604_0000126_15413_16144 243
142 3300047317 Ga0495604_0007745 Ga0495604_0007745_6290_7021 243
143 3300047322 Ga0495680_0000183 Ga0495680_0000183_53730_54464 243
144 3300047322 Ga0495680_0009007 Ga0495680_0009007_166_897 243
145 3300047444 Ga0495675_0000506 Ga0495675_0000506_3969_4700 243
146 3300047673 Ga0495593_0165763 Ga0495593_0165763_21_752 243
147 3300048088 Ga0495602_0000142 Ga0495602_0000142_7038_7769 243
148 3300048088 Ga0495602_0136465 Ga0495602_0136465_303_1034 243
149 3300048911 Ga0496108_0000001 Ga0496108_0000001_630219_630950 243
150 3300048911 Ga0496108_0000026 Ga0496108_0000026_120664_121395 243
151 3300048912 Ga0496109_0000003 Ga0496109_0000003_304765_305496 243
152 3300048912 Ga0496109_0000060 Ga0496109_0000060_46856_47587 243
153 3300048912 Ga0496109_0000075 Ga0496109_0000075_42021_42800 243
154 3300048913 Ga0496110_0000240 Ga0496110_0000240_28320_29051 243
155 3300048913 Ga0496110_0004297 Ga0496110_0004297_283_1014 243
156 3300048914 Ga0496111_0000355 Ga0496111_0000355_203_934 243
157 3300048914 Ga0496111_0017387 Ga0496111_0017387_2881_3612 243
158 3300048915 Ga0496112_0000013 Ga0496112_0000013_129651_130382 243
159 3300048915 Ga0496112_0004734 Ga0496112_0004734_6707_7438 243
160 3300048916 Ga0496113_0000090 Ga0496113_0000090_24855_25586 243
161 3300048916 Ga0496113_0322054 Ga0496113_0322054_160_891 243
162 3300049743 Ga0501081_0306482 Ga0501081_0306482_78_818 243
163 3300053077 Ga0495601_0000027 Ga0495601_0000027_7021_7752 243
164 3300053078 Ga0495612_0005037 Ga0495612_0005037_1144_1875 243
165 3300053084 Ga0495595_0000022 Ga0495595_0000022_105881_106612 243
166 3300053084 Ga0495595_0000107 Ga0495595_0000107_10922_11653 243
167 3300053085 Ga0495619_0000152 Ga0495619_0000152_25254_25985 243
168 3300053085 Ga0495619_0000222 Ga0495619_0000222_14177_14959 243
169 3300053085 Ga0495619_0080336 Ga0495619_0080336_1224_1955 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19567

CpsB_CapC

Capsular polysaccharide synthesis, CpsB/CapC

43

253

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wjd-assembly1.cif.gz_A crystal structure of the tyrosine phosphatase cps4b from steptococcus pneumoniae tigr4. 0.8733 1 235
2wjd-assembly1.cif.gz_A crystal structure of the tyrosine phosphatase cps4b from steptococcus pneumoniae tigr4. 0.8434 1 235
3qy7-assembly1.cif.gz_A crystal structures of ywqe from bacillus subtilis and cpsb from streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases 0.8388 1 241
3qy7-assembly1.cif.gz_A crystal structures of ywqe from bacillus subtilis and cpsb from streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases 0.8293 1 241
4e4r-assembly1.cif.gz_A-2 eutd phosphotransacetylase from staphylococcus aureus 0.6235 19 75
ID Description Score Start End Superfamily
3qy7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8389 1 241 3.20.20.140
3qy8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.834 1 235 3.20.20.140
3qy7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8293 1 241 3.20.20.140
af_Q2G1K6_1_254_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8028 1 243 3.20.20.140
af_Q2G1K6_1_254_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7998 1 243 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A537YQ99-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9696 1 243 GO:0004726
GO:0030145
GO:0030946
GO:0140793
AF-A0A3C1DM79-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9364 1 80 GO:0004726
GO:0030145
GO:0030946
GO:0140793
AF-A0A7W1NI94-F1-model_v4 deleted 0.9247 11 108
AF-A0A7V9M7B4-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9049 1 212 GO:0004725
GO:0030145
AF-A0A3C1DM79-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9044 1 80 GO:0004726
GO:0030145
GO:0030946
GO:0140793

Feature Viewer

pLDDT pTM Quality
88.12 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map