F254611

General Info

Members Datasets Scaffolds Average Seq Length
169 120 338 185

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10000382|Ga0111539_1000038229
Length 174
Sequence MRRFSRILLVLIAVTACAWVGIAAQGVIVLDTVKGSIEIETYPGDAPKSVAHIVELVQKGFYRGQRVHWATPGVAQMGDPSSRDMSKQDAWGRLYGTPVGVAELSKRPFDTGTVGLAYPKDRTALAAGSQFFILTRPNPQLNGKYTMIGKVTKGLAVAEKLEVGDMIKSASIKP

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
73 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
74 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
75 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
76 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 2.37
Rhizosphere 97.04
Stem 0
Stem Tuber 0
Unclassified 25.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10000382 3300009094 Bacteria 54624
2 Ga0070670_100441375 3300005331 Unclassified 1152
3 Ga0068869_100099500 3300005334 Bacteria 2198
4 Ga0070666_10190992 3300005335 Bacteria 1439
5 Ga0070666_10382048 3300005335 Bacteria 1011
6 Ga0068868_100211481 3300005338 Bacteria 1621
7 Ga0070687_100160274 3300005343 Bacteria 1329
8 Ga0070675_100484254 3300005354 Bacteria 1113
9 Ga0070674_100041522 3300005356 Bacteria 3119
10 Ga0070709_10068735 3300005434 Bacteria 2279
11 Ga0070709_10274218 3300005434 Bacteria 1223
12 Ga0070714_100004449 3300005435 Bacteria 10556
13 Ga0070713_100016957 3300005436 Bacteria 5492
14 Ga0070705_100238239 3300005440 Bacteria 1270
15 Ga0070694_100867101 3300005444 Unclassified 744
16 Ga0070708_100416993 3300005445 Unclassified 1266
17 Ga0070698_100040777 3300005471 Bacteria 4769
18 Ga0070698_100817504 3300005471 Unclassified 876
19 Ga0070698_100904495 3300005471 Bacteria 828
20 Ga0070699_100082115 3300005518 Bacteria 2809
21 Ga0070684_100354580 3300005535 Unclassified 1349
22 Ga0070704_100575190 3300005549 Unclassified 987
23 Ga0068859_100315255 3300005617 Unclassified 1658
24 Ga0068859_100491823 3300005617 Bacteria 1322
25 Ga0068861_100083917 3300005719 Bacteria 2500
26 Ga0068863_100303188 3300005841 Unclassified 1550
27 Ga0068858_100081887 3300005842 Bacteria 3000
28 Ga0068858_100162785 3300005842 Unclassified 2101
29 Ga0068860_100196831 3300005843 Bacteria 1952
30 Ga0068860_100405113 3300005843 Bacteria 1350
31 Ga0068862_101134073 3300005844 Bacteria 778
32 Ga0081539_10009345 3300005985 Bacteria 8224
33 Ga0070717_10022151 3300006028 Bacteria 5018
34 Ga0070715_10181747 3300006163 Bacteria 1055
35 Ga0070716_100128474 3300006173 Bacteria 1598
36 Ga0097621_100001463 3300006237 Bacteria 16164
37 Ga0097621_100069168 3300006237 Bacteria 2914
38 Ga0068871_100004243 3300006358 Bacteria 9935
39 Ga0068871_100052936 3300006358 Bacteria 3289
40 Ga0075428_100167261 3300006844 Bacteria 2385
41 Ga0075433_10075352 3300006852 Bacteria 2969
42 Ga0068865_100292346 3300006881 Unclassified 1301
43 Ga0075436_100000420 3300006914 Bacteria 27162
44 Ga0097620_100315273 3300006931 Unclassified 1658
45 Ga0097620_100491784 3300006931 Bacteria 1322
46 Ga0097620_100586822 3300006931 Bacteria 1208
47 Ga0097620_100999611 3300006931 Unclassified 919
48 Ga0075435_100000059 3300007076 Bacteria 56189
49 Ga0105242_10154623 3300009176 Bacteria 2003
50 Ga0105242_10677705 3300009176 Bacteria 1006
51 Ga0105248_10133183 3300009177 Bacteria 2804
52 Ga0105248_10193710 3300009177 Bacteria 2290
53 Ga0105248_10344351 3300009177 Unclassified 1678
54 Ga0105248_11196156 3300009177 Bacteria 859
55 Ga0105249_10342744 3300009553 Bacteria 1512
56 Ga0105246_10144903 3300011119 Bacteria 1791
57 Ga0157374_10059283 3300013296 Bacteria 3579
58 Ga0157374_10461932 3300013296 Bacteria 1271
59 Ga0157374_10774064 3300013296 Unclassified 975
60 Ga0157378_10012087 3300013297 Bacteria 7561
61 Ga0157375_10352380 3300013308 Bacteria 1638
62 Ga0157375_10574529 3300013308 Bacteria 1288
63 Ga0163163_10070659 3300014325 Bacteria 3477
64 Ga0157380_10010700 3300014326 Bacteria 6610
65 Ga0157376_10038389 3300014969 Bacteria 3896
66 Ga0157376_10183547 3300014969 Bacteria 1914
67 Ga0207656_10029242 3300025321 Unclassified 2268
68 Ga0207680_10351594 3300025903 Unclassified 1035
69 Ga0207699_10085100 3300025906 Bacteria 1971
70 Ga0207662_10193727 3300025918 Unclassified 1313
71 Ga0207662_10519635 3300025918 Bacteria 822
72 Ga0207646_10580414 3300025922 Bacteria 1007
73 Ga0207659_10000075 3300025926 Bacteria 63221
74 Ga0207664_10151303 3300025929 Bacteria 1971
75 Ga0207704_10024531 3300025938 Unclassified 3273
76 Ga0207704_10208576 3300025938 Unclassified 1436
77 Ga0207665_10266735 3300025939 Bacteria 1270
78 Ga0207691_10301251 3300025940 Bacteria 1377
79 Ga0207711_10065853 3300025941 Unclassified 3132
80 Ga0207711_10095092 3300025941 Bacteria 2627
81 Ga0207711_10329556 3300025941 Unclassified 1412
82 Ga0207711_10778361 3300025941 Bacteria 891
83 Ga0207689_10095648 3300025942 Bacteria 2440
84 Ga0207712_10246816 3300025961 Unclassified 1441
85 Ga0207703_10175846 3300026035 Unclassified 1886
86 Ga0207703_10183785 3300026035 Bacteria 1847
87 Ga0207703_10188369 3300026035 Bacteria 1825
88 Ga0207641_10303549 3300026088 Unclassified 1509
89 Ga0207676_10083745 3300026095 Bacteria 2598
90 Ga0207675_100114231 3300026118 Bacteria 2550
91 Ga0207675_100115607 3300026118 Bacteria 2535
92 Ga0207675_100316005 3300026118 Unclassified 1524
93 Ga0207428_10000899 3300027907 Bacteria 33202
94 Ga0268266_10008922 3300028379 Bacteria 8873
95 Ga0268264_10042594 3300028381 Bacteria 3759
96 Ga0265332_10018813 3300031238 Unclassified 3050
97 Ga0265320_10095085 3300031240 Unclassified 1377
98 Ga0307408_100040174 3300031548 Bacteria 3312
99 Ga0265314_10145999 3300031711 Bacteria 1457
100 Ga0307416_100673935 3300032002 Unclassified 1121
101 Ga0373944_0039368 3300035089 Bacteria 1455
102 Ga0373939_0016467 3300035114 Bacteria 1950
103 Ga0373941_0200751 3300035115 Bacteria 758
104 Ga0373956_0059468 3300035119 Bacteria 1729
105 Ga0373960_0191302 3300035121 Bacteria 719
106 Ga0373943_0009943 3300035170 Bacteria 4264
107 Ga0373946_0127118 3300035171 Bacteria 1169
108 Ga0373946_0146346 3300035171 Bacteria 1099
109 Ga0373955_0152788 3300035172 Bacteria 1359
110 Ga0373955_0247751 3300035172 Bacteria 1068
111 Ga0373955_0583915 3300035172 Bacteria 684
112 Ga0373955_0684151 3300035172 Unclassified 629
113 Ga0373924_0065698 3300035410 Bacteria 1523
114 Ga0373935_0019336 3300035692 Bacteria 4154
115 Ga0373935_0193908 3300035692 Bacteria 1401
116 Ga0373935_0452394 3300035692 Unclassified 928
117 Ga0373933_0561655 3300035724 Unclassified 749
118 Ga0373947_0413991 3300035725 Unclassified 910
119 Ga0373937_0173113 3300036401 Bacteria 2026
120 Ga0373937_0732674 3300036401 Viruses 936
121 Ga0373937_0920238 3300036401 Unclassified 823
122 Ga0373925_0046122 3300037068 Bacteria 3240
123 Ga0373925_0247062 3300037068 Bacteria 1430
124 Ga0466963_0035604 3300044694 Bacteria 3244
125 Ga0495592_0085149 3300046454 Bacteria 2279
126 Ga0495629_0191275 3300046459 Bacteria 1416
127 Ga0495608_0000803 3300046511 Bacteria 22031
128 Ga0495628_0112762 3300046516 Bacteria 2090
129 Ga0495630_0037652 3300046517 Bacteria 3617
130 Ga0495652_0380568 3300046529 Bacteria 1004
131 Ga0495640_0211688 3300046533 Bacteria 1225
132 Ga0495667_0333733 3300046559 Unclassified 959
133 Ga0495635_0637185 3300046663 Unclassified 694
134 Ga0495647_0011190 3300046681 Bacteria 3070
135 Ga0495647_0175443 3300046681 Bacteria 930
136 Ga0495658_0103166 3300046683 Bacteria 1705
137 Ga0495658_0151226 3300046683 Bacteria 1426
138 Ga0495613_0055262 3300046689 Bacteria 2917
139 Ga0495670_0238144 3300046691 Bacteria 969
140 Ga0495670_0303348 3300046691 Unclassified 856
141 Ga0495581_0096581 3300047315 Bacteria 1716
142 Ga0495581_0289268 3300047315 Bacteria 958
143 Ga0495604_0439582 3300047317 Unclassified 854
144 Ga0495674_0277842 3300047319 Bacteria 1373
145 Ga0495675_0254052 3300047444 Bacteria 1055
146 Ga0495684_0001776 3300047471 Bacteria 17286
147 Ga0496100_0522382 3300048903 Unclassified 916
148 Ga0496104_0141415 3300048907 Bacteria 2312
149 Ga0496112_0263236 3300048915 Bacteria 1674
150 Ga0496114_0082030 3300048917 Bacteria 2725
151 Ga0501072_0258374 3300049588 Bacteria 1387
152 Ga0501207_049037 3300049654 Unclassified 750
153 Ga0501083_0210978 3300049744 Unclassified 1266
154 nmdc:mga06z11_468248_c1 3300050494 Bacteria 762
155 nmdc:mga05p37_292314_c1 3300050507 Bacteria 1939
156 nmdc:mga05p37_376466_c1 3300050507 Bacteria 1665
157 nmdc:mga05p37_5071_c1 3300050507 Bacteria 15438
158 nmdc:mga08y16_3780_c1 3300050511 Bacteria 15769
159 nmdc:mga08y16_524300_c1 3300050511 Unclassified 1201
160 nmdc:mga0n895_14984_c1 3300050512 Bacteria 7062
161 nmdc:mga0n895_95_c1 3300050512 Bacteria 52030
162 nmdc:mga0rr50_177700_c1 3300050513 Unclassified 1739
163 nmdc:mga0rr50_28_c1 3300050513 Bacteria 108950
164 nmdc:mga08x19_121_c1 3300050514 Bacteria 69968
165 nmdc:mga08x19_256368_c1 3300050514 Unclassified 1209
166 nmdc:mga0a205_6759_c1 3300050515 Bacteria 10372
167 Ga0495601_0002777 3300053077 Bacteria 9942
168 Ga0495601_0103623 3300053077 Bacteria 1839
169 Ga0495619_0001563 3300053085 Bacteria 15064
170 Ga0111539_10000382
171 Ga0070670_100441375
172 Ga0068869_100099500
173 Ga0070666_10190992
174 Ga0070666_10382048
175 Ga0068868_100211481
176 Ga0070687_100160274
177 Ga0070675_100484254
178 Ga0070674_100041522
179 Ga0070709_10068735
180 Ga0070709_10274218
181 Ga0070714_100004449
182 Ga0070713_100016957
183 Ga0070705_100238239
184 Ga0070694_100867101
185 Ga0070708_100416993
186 Ga0070698_100040777
187 Ga0070698_100817504
188 Ga0070698_100904495
189 Ga0070699_100082115
190 Ga0070684_100354580
191 Ga0070704_100575190
192 Ga0068859_100315255
193 Ga0068859_100491823
194 Ga0068861_100083917
195 Ga0068863_100303188
196 Ga0068858_100081887
197 Ga0068858_100162785
198 Ga0068860_100196831
199 Ga0068860_100405113
200 Ga0068862_101134073
201 Ga0081539_10009345
202 Ga0070717_10022151
203 Ga0070715_10181747
204 Ga0070716_100128474
205 Ga0097621_100001463
206 Ga0097621_100069168
207 Ga0068871_100004243
208 Ga0068871_100052936
209 Ga0075428_100167261
210 Ga0075433_10075352
211 Ga0068865_100292346
212 Ga0075436_100000420
213 Ga0097620_100315273
214 Ga0097620_100491784
215 Ga0097620_100586822
216 Ga0097620_100999611
217 Ga0075435_100000059
218 Ga0105242_10154623
219 Ga0105242_10677705
220 Ga0105248_10133183
221 Ga0105248_10193710
222 Ga0105248_10344351
223 Ga0105248_11196156
224 Ga0105249_10342744
225 Ga0105246_10144903
226 Ga0157374_10059283
227 Ga0157374_10461932
228 Ga0157374_10774064
229 Ga0157378_10012087
230 Ga0157375_10352380
231 Ga0157375_10574529
232 Ga0163163_10070659
233 Ga0157380_10010700
234 Ga0157376_10038389
235 Ga0157376_10183547
236 Ga0207656_10029242
237 Ga0207680_10351594
238 Ga0207699_10085100
239 Ga0207662_10193727
240 Ga0207662_10519635
241 Ga0207646_10580414
242 Ga0207659_10000075
243 Ga0207664_10151303
244 Ga0207704_10024531
245 Ga0207704_10208576
246 Ga0207665_10266735
247 Ga0207691_10301251
248 Ga0207711_10065853
249 Ga0207711_10095092
250 Ga0207711_10329556
251 Ga0207711_10778361
252 Ga0207689_10095648
253 Ga0207712_10246816
254 Ga0207703_10175846
255 Ga0207703_10183785
256 Ga0207703_10188369
257 Ga0207641_10303549
258 Ga0207676_10083745
259 Ga0207675_100114231
260 Ga0207675_100115607
261 Ga0207675_100316005
262 Ga0207428_10000899
263 Ga0268266_10008922
264 Ga0268264_10042594
265 Ga0265332_10018813
266 Ga0265320_10095085
267 Ga0307408_100040174
268 Ga0265314_10145999
269 Ga0307416_100673935
270 Ga0373944_0039368
271 Ga0373939_0016467
272 Ga0373941_0200751
273 Ga0373956_0059468
274 Ga0373960_0191302
275 Ga0373943_0009943
276 Ga0373946_0127118
277 Ga0373946_0146346
278 Ga0373955_0152788
279 Ga0373955_0247751
280 Ga0373955_0583915
281 Ga0373955_0684151
282 Ga0373924_0065698
283 Ga0373935_0019336
284 Ga0373935_0193908
285 Ga0373935_0452394
286 Ga0373933_0561655
287 Ga0373947_0413991
288 Ga0373937_0173113
289 Ga0373937_0732674
290 Ga0373937_0920238
291 Ga0373925_0046122
292 Ga0373925_0247062
293 Ga0466963_0035604
294 Ga0495592_0085149
295 Ga0495629_0191275
296 Ga0495608_0000803
297 Ga0495628_0112762
298 Ga0495630_0037652
299 Ga0495652_0380568
300 Ga0495640_0211688
301 Ga0495667_0333733
302 Ga0495635_0637185
303 Ga0495647_0011190
304 Ga0495647_0175443
305 Ga0495658_0103166
306 Ga0495658_0151226
307 Ga0495613_0055262
308 Ga0495670_0238144
309 Ga0495670_0303348
310 Ga0495581_0096581
311 Ga0495581_0289268
312 Ga0495604_0439582
313 Ga0495674_0277842
314 Ga0495675_0254052
315 Ga0495684_0001776
316 Ga0496100_0522382
317 Ga0496104_0141415
318 Ga0496112_0263236
319 Ga0496114_0082030
320 Ga0501072_0258374
321 Ga0501207_049037
322 Ga0501083_0210978
323 nmdc:mga06z11_468248_c1
324 nmdc:mga05p37_292314_c1
325 nmdc:mga05p37_376466_c1
326 nmdc:mga05p37_5071_c1
327 nmdc:mga08y16_3780_c1
328 nmdc:mga08y16_524300_c1
329 nmdc:mga0n895_14984_c1
330 nmdc:mga0n895_95_c1
331 nmdc:mga0rr50_177700_c1
332 nmdc:mga0rr50_28_c1
333 nmdc:mga08x19_121_c1
334 nmdc:mga08x19_256368_c1
335 nmdc:mga0a205_6759_c1
336 Ga0495601_0002777
337 Ga0495601_0103623
338 Ga0495619_0001563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00160

Pro_isomerase

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

27

174

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mvz-assembly1.cif.gz_A solution structure for cyclophilin a from geobacillus kaustophilus 0.8535 31 183
7aoi-assembly1.cif.gz_BQ trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate 0.84 30 183
6yxy-assembly1.cif.gz_BQ state b of the trypanosoma brucei mitoribosomal large subunit assembly intermediate 0.8349 30 183
2mvz-assembly1.cif.gz_A solution structure for cyclophilin a from geobacillus kaustophilus 0.8319 31 183
3eov-assembly1.cif.gz_A crystal structure of cyclophilin from leishmania donovani ligated with cyclosporin a 0.8294 29 182
ID Description Score Start End Superfamily
2mvzA00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8535 31 183 2.40.100.10
2mvzA00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8319 31 183 2.40.100.10
af_A0A0R4J2Z8_2_164_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8278 25 183 2.40.100.10
1w74B00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8043 28 182 2.40.100.10
af_A0A0R4J2Z8_2_164_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8039 25 183 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A1F2TLL0-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9575 34 183 GO:0140839
GO:0140840
AF-V7ZGY1-F1-model_v4 deleted 0.9547 23 182
AF-A0A838NKD0-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.954 30 182 GO:0003755
GO:0006457
AF-A0A2V6EZ34-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9534 31 183 GO:0006457
GO:0140839
GO:0140840
AF-A0A2V8FNY8-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9513 65 183 GO:0140839
GO:0140840

Map