F253744

General Info

Members Datasets Scaffolds Average Seq Length
168 109 337 207

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8048127548|8048135932
Length 253
Sequence LARVDAVLVQAVIAAALSFAHLHDLASAAGQDGWKAWAYPVSVDLLLVAAWKRLRSGASKAAGWCWFVVALAASLGANVATAGLLDLADVPDWLRILVAGWPAVAFLGGTLLAHTSAPLSNRDGSTTPQERDRRPPAIRRTPHTRRQAGAVADPLETRTTQPGTQPSARSEANDSRSGEVPATQPAVDEQADPIDDLAVPPSATVKLPPALVAHARKLADDHHARTGSPIDPETLRARLGVPAPLADAIASRL

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
5 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
6 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
7 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
8 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
9 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
10 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
11 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
12 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
13 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
14 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
15 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
16 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
17 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
18 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
19 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
20 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
21 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
22 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
23 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
24 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
25 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
26 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
27 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
28 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
29 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
30 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
31 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
32 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
33 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
34 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
35 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
36 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
37 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
38 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
39 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
40 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
41 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
42 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
43 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
44 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
45 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
46 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
47 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
48 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
49 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
50 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
51 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
52 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
53 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
55 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
57 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
58 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
59 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
61 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
62 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
63 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
64 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
65 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
66 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
67 2643221548 Streptomyces sp. Root55 Isolate Unclassified
68 2643221578 Streptomyces sp. Root63 Isolate Unclassified
69 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
70 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
71 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
72 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
73 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
74 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
75 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
76 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
77 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
78 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
79 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
80 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
81 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
82 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
83 2867369537 Streptomyces sp. Z26 Isolate Unclassified
84 2867428634 Streptomyces sp. RP5T Isolate Unclassified
85 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
86 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
87 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
88 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
89 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
90 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
91 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
92 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
93 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
94 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
95 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
96 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
97 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
98 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
99 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
100 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
101 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
102 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
103 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
104 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
105 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
106 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
107 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
108 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
109 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 56.55
Metatranscriptomes 1.19
Isolates 42.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 0
Rhizosphere 72.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10004997 3300003316 Bacteria 8283
2 rootH1_10004997 3300003323 Bacteria 38164
3 rootL2_10086061 3300003322 Bacteria 5372
4 Ga0006562J51391_1140752 3300003578 Bacteria 6320
5 Ga0006562J51391_1140754 3300003578 Bacteria 5870
6 Ga0207426_1001414 3300025302 Bacteria 20103
7 Ga0307511_10000029 3300030521 Bacteria 108570
8 Ga0307511_10014532 3300030521 Bacteria 7662
9 Ga0307518_10009386 3300031838 Bacteria 6979
10 Ga0307518_10016384 3300031838 Bacteria 5312
11 Ga0307507_10062540 3300033179 Bacteria 3456
12 Ga0307510_10179525 3300033180 Bacteria 1682
13 Ga0466972_0024113 3300044658 Bacteria 3020
14 Ga0466968_0057937 3300044735 Bacteria 1666
15 Ga0466970_0014588 3300044765 Bacteria 4036
16 Ga0495617_009235 3300046452 Bacteria 3386
17 Ga0495617_114022 3300046452 Bacteria 873
18 Ga0495603_0013436 3300046455 Bacteria 4952
19 Ga0495603_0075261 3300046455 Bacteria 1982
20 Ga0495603_0086958 3300046455 Bacteria 1829
21 Ga0495603_0144650 3300046455 Bacteria 1382
22 Ga0495629_0002527 3300046459 Bacteria 14027
23 Ga0495629_0069441 3300046459 Bacteria 2458
24 Ga0495605_0001984 3300046474 Bacteria 12958
25 Ga0495605_0012818 3300046474 Bacteria 4639
26 Ga0495639_0100794 3300046475 Bacteria 1363
27 Ga0495585_0005228 3300046492 Bacteria 8226
28 Ga0495594_0101252 3300046499 Bacteria 1620
29 Ga0495594_0199055 3300046499 Bacteria 1142
30 Ga0495596_0043404 3300046500 Bacteria 1772
31 Ga0495607_0069983 3300046501 Bacteria 1962
32 Ga0495583_0004435 3300046506 Bacteria 10047
33 Ga0495583_0013328 3300046506 Bacteria 4590
34 Ga0495606_0053049 3300046507 Bacteria 2633
35 Ga0495606_0224803 3300046507 Bacteria 1055
36 Ga0495610_0105327 3300046512 Bacteria 1257
37 Ga0495616_0036564 3300046513 Bacteria 2533
38 Ga0495620_0003271 3300046515 Bacteria 9287
39 Ga0495628_0098936 3300046516 Bacteria 2253
40 Ga0495631_0004127 3300046518 Bacteria 7792
41 Ga0495631_0247241 3300046518 Bacteria 760
42 Ga0495643_0233032 3300046522 Bacteria 867
43 Ga0495597_0004943 3300046542 Bacteria 7165
44 Ga0495597_0035065 3300046542 Bacteria 2265
45 Ga0495622_0058148 3300046557 Bacteria 1791
46 Ga0495622_0140545 3300046557 Bacteria 1096
47 Ga0495622_0256071 3300046557 Bacteria 769
48 Ga0495668_0003453 3300046616 Bacteria 11820
49 Ga0495634_0240770 3300046642 Bacteria 1110
50 Ga0495611_0014478 3300046648 Bacteria 3370
51 Ga0495611_0047208 3300046648 Bacteria 1932
52 Ga0495611_0308135 3300046648 Bacteria 729
53 Ga0495611_0313468 3300046648 Bacteria 722
54 Ga0495625_0008311 3300046660 Bacteria 8869
55 Ga0495625_0009372 3300046660 Bacteria 8197
56 Ga0495661_0189623 3300046665 Bacteria 1084
57 Ga0495588_0035487 3300046674 Bacteria 2527
58 Ga0495613_0032576 3300046689 Bacteria 3872
59 Ga0495613_0086740 3300046689 Bacteria 2269
60 Ga0495624_0470567 3300046690 Bacteria 753
61 Ga0495649_0083465 3300046694 Bacteria 1707
62 Ga0495589_0004561 3300046794 Bacteria 7360
63 Ga0495589_0057817 3300046794 Bacteria 1907
64 Ga0495600_0010265 3300046809 Bacteria 5806
65 Ga0495600_0020594 3300046809 Bacteria 4217
66 Ga0495660_0002958 3300046810 Bacteria 10630
67 Ga0495660_0006544 3300046810 Bacteria 6884
68 Ga0495604_0000226 3300047317 Bacteria 50983
69 Ga0495636_0014438 3300047318 Bacteria 3140
70 Ga0495676_0003189 3300047321 Bacteria 14820
71 Ga0495676_0013018 3300047321 Bacteria 7487
72 Ga0495676_0028527 3300047321 Bacteria 4764
73 Ga0495676_0092202 3300047321 Bacteria 2262
74 Ga0495676_0144405 3300047321 Bacteria 1701
75 Ga0495683_0011459 3300047323 Bacteria 4666
76 Ga0495687_021641 3300047443 Bacteria 3105
77 Ga0495687_047362 3300047443 Bacteria 1850
78 Ga0495687_054934 3300047443 Bacteria 1668
79 Ga0495687_056101 3300047443 Bacteria 1645
80 Ga0495685_001808 3300047447 Bacteria 6597
81 Ga0495685_042722 3300047447 Bacteria 1547
82 Ga0495681_0131094 3300047470 Bacteria 1067
83 Ga0495593_0002993 3300047673 Bacteria 10178
84 Ga0495614_0048058 3300048089 Bacteria 1830
85 Ga0495614_0066626 3300048089 Bacteria 1549
86 Ga0495614_0080725 3300048089 Bacteria 1409
87 Ga0495614_0123795 3300048089 Bacteria 1141
88 Ga0495614_0394959 3300048089 Bacteria 649
89 Ga0495626_0045576 3300048091 Bacteria 2046
90 Ga0501033_0004941 3300049570 Bacteria 10603
91 Ga0501036_0014831 3300049572 Bacteria 6500
92 Ga0501047_0007312 3300049581 Bacteria 10385
93 Ga0501068_0385878 3300049584 Bacteria 902
94 Ga0501070_0129595 3300049586 Bacteria 2084
95 Ga0501074_0045741 3300049590 Bacteria 3166
96 Ga0501035_0004872 3300049822 Bacteria 12731
97 Ga0501044_0031534 3300049823 Bacteria 5578
98 Ga0500660_150682 3300053100 Bacteria 903
99 8048135932 8048127548 Bacteria 11053136
100 2554257583 2554235005 Bacteria 6457341
101 2554257970 2554235005 Bacteria 6457341
102 2585299294 2582581312 Bacteria 7308206
103 2585300988 2582581312 Bacteria 7308206
104 2585304810 2582581313 Bacteria 10042643
105 2616699994 2616644814 Bacteria 11555299
106 2643765084 2643221548 Bacteria 8053412
107 2643900071 2643221578 Bacteria 9213798
108 2643943864 2643221587 Bacteria 7586415
109 2643944324 2643221587 Bacteria 7586415
110 2644405705 2643221673 Bacteria 9196637
111 2644429822 2643221677 Bacteria 7584031
112 2644431222 2643221677 Bacteria 7584031
113 2644434601 2643221677 Bacteria 7584031
114 2644436011 2643221678 Bacteria 9540101
115 2644437045 2643221678 Bacteria 9540101
116 2644440007 2643221678 Bacteria 9540101
117 2644461078 2643221682 Bacteria 6743283
118 2644464063 2643221682 Bacteria 6743283
119 2784588957 2784132148 Bacteria 8627943
120 2785342470 2784746763 Bacteria 9783172
121 2785343451 2784746763 Bacteria 9783172
122 2793982140 2791355406 Bacteria 11364898
123 2804846608 2802429296 Bacteria 7227771
124 2808913579 2808606375 Bacteria 9466072
125 2808919805 2808606375 Bacteria 9466072
126 2808921028 2808606375 Bacteria 9466072
127 2812355989 2811994879 Bacteria 9313447
128 2862287477 2862281513 Bacteria 9621493
129 2862291443 2862290372 Bacteria 7471434
130 2862508184 2862507626 Bacteria 9425308
131 2867372299 2867369537 Bacteria 6501581
132 2867373816 2867369537 Bacteria 6501581
133 2867434399 2867428634 Bacteria 9590268
134 2873155839 2873151551 Bacteria 8625867
135 2877681460 2877676314 Bacteria 9512378
136 2877681914 2877676314 Bacteria 9512378
137 2935390888 2935390628 Bacteria 7043367
138 2946049585 2946045630 Bacteria 8527308
139 2946051114 2946045630 Bacteria 8527308
140 2954385463 2954380949 Bacteria 10050426
141 2954676125 2954673503 Bacteria 9685905
142 2954678908 2954673503 Bacteria 9685905
143 2954685243 2954682443 Bacteria 9862841
144 2954688042 2954682443 Bacteria 9862841
145 2954704851 2954701450 Bacteria 10834262
146 2954705425 2954701450 Bacteria 10834262
147 2954714035 2954711539 Bacteria 10867210
148 2954715848 2954711539 Bacteria 10867210
149 2954725850 2954721474 Bacteria 10456478
150 2954735278 2954731030 Bacteria 10243860
151 2954735948 2954731030 Bacteria 10243860
152 2954754875 2954749733 Bacteria 10366972
153 2954756688 2954749733 Bacteria 10366972
154 2954763772 2954759201 Bacteria 9358192
155 2966601783 2966598605 Bacteria 7676064
156 2990048746 2990044586 Bacteria 6603797
157 2990061494 2990059506 Bacteria 9321252
158 3006425912 3006425503 Bacteria 6491253
159 3006500076 3006493962 Bacteria 8825450
160 3006500176 3006493962 Bacteria 8825450
161 8008487140 8008485437 Bacteria 7198341
162 8025415965 8025413630 Bacteria 7014048
163 8025525099 8025524527 Bacteria 7197316
164 8033687098 8033684223 Bacteria 6906479
165 8048129496 8048127548 Bacteria 11053136
166 8048361502 8048356638 Bacteria 11044339
167 8048383296 8048379754 Bacteria 11877923
168 8048411971 8048406513 Bacteria 8936924
169 8048414401 8048406513 Bacteria 8936924
170 rootH1_10004997
171 rootL2_10086061
172 Ga0006562J51391_1140752
173 Ga0006562J51391_1140754
174 Ga0207426_1001414
175 Ga0307511_10000029
176 Ga0307511_10014532
177 Ga0307518_10009386
178 Ga0307518_10016384
179 Ga0307507_10062540
180 Ga0307510_10179525
181 Ga0466972_0024113
182 Ga0466968_0057937
183 Ga0466970_0014588
184 Ga0495617_009235
185 Ga0495617_114022
186 Ga0495603_0013436
187 Ga0495603_0075261
188 Ga0495603_0086958
189 Ga0495603_0144650
190 Ga0495629_0002527
191 Ga0495629_0069441
192 Ga0495605_0001984
193 Ga0495605_0012818
194 Ga0495639_0100794
195 Ga0495585_0005228
196 Ga0495594_0101252
197 Ga0495594_0199055
198 Ga0495596_0043404
199 Ga0495607_0069983
200 Ga0495583_0004435
201 Ga0495583_0013328
202 Ga0495606_0053049
203 Ga0495606_0224803
204 Ga0495610_0105327
205 Ga0495616_0036564
206 Ga0495620_0003271
207 Ga0495628_0098936
208 Ga0495631_0004127
209 Ga0495631_0247241
210 Ga0495643_0233032
211 Ga0495597_0004943
212 Ga0495597_0035065
213 Ga0495622_0058148
214 Ga0495622_0140545
215 Ga0495622_0256071
216 Ga0495668_0003453
217 Ga0495634_0240770
218 Ga0495611_0014478
219 Ga0495611_0047208
220 Ga0495611_0308135
221 Ga0495611_0313468
222 Ga0495625_0008311
223 Ga0495625_0009372
224 Ga0495661_0189623
225 Ga0495588_0035487
226 Ga0495613_0032576
227 Ga0495613_0086740
228 Ga0495624_0470567
229 Ga0495649_0083465
230 Ga0495589_0004561
231 Ga0495589_0057817
232 Ga0495600_0010265
233 Ga0495600_0020594
234 Ga0495660_0002958
235 Ga0495660_0006544
236 Ga0495604_0000226
237 Ga0495636_0014438
238 Ga0495676_0003189
239 Ga0495676_0013018
240 Ga0495676_0028527
241 Ga0495676_0092202
242 Ga0495676_0144405
243 Ga0495683_0011459
244 Ga0495687_021641
245 Ga0495687_047362
246 Ga0495687_054934
247 Ga0495687_056101
248 Ga0495685_001808
249 Ga0495685_042722
250 Ga0495681_0131094
251 Ga0495593_0002993
252 Ga0495614_0048058
253 Ga0495614_0066626
254 Ga0495614_0080725
255 Ga0495614_0123795
256 Ga0495614_0394959
257 Ga0495626_0045576
258 Ga0501033_0004941
259 Ga0501036_0014831
260 Ga0501047_0007312
261 Ga0501068_0385878
262 Ga0501070_0129595
263 Ga0501074_0045741
264 Ga0501035_0004872
265 Ga0501044_0031534
266 Ga0500660_150682
267 8048135932
268 2554257583
269 2554257970
270 2585299294
271 2585300988
272 2585304810
273 2616699994
274 2643765084
275 2643900071
276 2643943864
277 2643944324
278 2644405705
279 2644429822
280 2644431222
281 2644434601
282 2644436011
283 2644437045
284 2644440007
285 2644461078
286 2644464063
287 2784588957
288 2785342470
289 2785343451
290 2793982140
291 2804846608
292 2808913579
293 2808919805
294 2808921028
295 2812355989
296 2862287477
297 2862291443
298 2862508184
299 2867372299
300 2867373816
301 2867434399
302 2873155839
303 2877681460
304 2877681914
305 2935390888
306 2946049585
307 2946051114
308 2954385463
309 2954676125
310 2954678908
311 2954685243
312 2954688042
313 2954704851
314 2954705425
315 2954714035
316 2954715848
317 2954725850
318 2954735278
319 2954735948
320 2954754875
321 2954756688
322 2954763772
323 2966601783
324 2990048746
325 2990061494
326 3006425912
327 3006500076
328 3006500176
329 8008487140
330 8025415965
331 8025525099
332 8033687098
333 8048129496
334 8048361502
335 8048383296
336 8048411971
337 8048414401

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10935

DUF2637

Protein of unknown function (DUF2637)

1

134

0.93

Map