F248565

General Info

Members Datasets Scaffolds Average Seq Length
166 131 166 122

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10735331|Ga0207712_107353312
Length 150
Sequence VRRASGTRADAALLSLDLTDVPAGLRGPVAVALAATGVDDGHLAVELVDAARIRDLNRKHRGKDAPTDVLAFPIDETAPTAGPRELGDVAICPEHCSDVTEAAVHGVLHLCGYDHETDAGEMLALQREVMHSLETPPPPDAGARARGFRV

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
60 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
70 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
71 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
72 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
73 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
74 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
75 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
76 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
80 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
84 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
85 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
86 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
87 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
88 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
89 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
92 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
96 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
99 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
125 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
126 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
127 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
128 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
129 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 12.65
Rhizosphere 84.34
Stem 0
Stem Tuber 0
Unclassified 1.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10000172 3300002239 Bacteria 8945
2 JGI24742J22300_10001057 3300002244 Bacteria 4244
3 Ga0070658_10670598 3300005327 Bacteria 900
4 Ga0070683_100072876 3300005329 Bacteria 3207
5 Ga0070677_10000082 3300005333 Bacteria 30305
6 Ga0068869_100935445 3300005334 Bacteria 752
7 Ga0070682_100000030 3300005337 Bacteria 182768
8 Ga0068868_100000033 3300005338 Bacteria 75402
9 Ga0070689_100067986 3300005340 Bacteria 2778
10 Ga0070691_10000036 3300005341 Bacteria 38327
11 Ga0070692_10092949 3300005345 Bacteria 1642
12 Ga0070675_101146888 3300005354 Bacteria 715
13 Ga0070688_100000016 3300005365 Bacteria 73740
14 Ga0070667_100195163 3300005367 Bacteria 1795
15 Ga0070713_100000058 3300005436 Bacteria 70009
16 Ga0070713_100349890 3300005436 Bacteria 1371
17 Ga0070711_100810447 3300005439 Bacteria 794
18 Ga0070700_100721720 3300005441 Bacteria 795
19 Ga0070678_100285711 3300005456 Bacteria 1397
20 Ga0070681_10034036 3300005458 Bacteria 5117
21 Ga0070685_10000053 3300005466 Bacteria 70868
22 Ga0070679_100005540 3300005530 Bacteria 11698
23 Ga0070684_100035744 3300005535 Bacteria 4254
24 Ga0068853_100013254 3300005539 Bacteria 6730
25 Ga0070665_100000040 3300005548 Bacteria 305480
26 Ga0070665_100240355 3300005548 Bacteria 1812
27 Ga0068855_101443636 3300005563 Bacteria 708
28 Ga0068857_100692480 3300005577 Bacteria 968
29 Ga0068856_100003571 3300005614 Bacteria 15652
30 Ga0070702_100020017 3300005615 Bacteria 3500
31 Ga0068851_10052354 3300005834 Bacteria 2076
32 Ga0068858_100000069 3300005842 Bacteria 105617
33 Ga0068858_100000156 3300005842 Bacteria 72781
34 Ga0081540_1050979 3300005983 Bacteria 2050
35 Ga0105238_10000009 3300009551 Bacteria 288729
36 Ga0105249_10999320 3300009553 Bacteria 905
37 Ga0157378_10026980 3300013297 Bacteria 5066
38 Ga0163162_10355900 3300013306 Bacteria 1597
39 Ga0163162_10897479 3300013306 Bacteria 1000
40 Ga0157375_10000584 3300013308 Bacteria 32509
41 Ga0157375_11161209 3300013308 Bacteria 905
42 Ga0206356_11904470 3300020070 Bacteria 1022
43 Ga0207656_10032190 3300025321 Bacteria 2177
44 Ga0207682_10000018 3300025893 Bacteria 66215
45 Ga0207710_10017816 3300025900 Bacteria 3014
46 Ga0207685_10079166 3300025905 Bacteria 1355
47 Ga0207705_10272239 3300025909 Bacteria 1295
48 Ga0207663_10427495 3300025916 Bacteria 1018
49 Ga0207694_10000004 3300025924 Bacteria 967075
50 Ga0207687_10001695 3300025927 Bacteria 15197
51 Ga0207700_10000003 3300025928 Bacteria 500797
52 Ga0207700_10163598 3300025928 Bacteria 1850
53 Ga0207670_10043523 3300025936 Bacteria 2966
54 Ga0207661_10052100 3300025944 Bacteria 3268
55 Ga0207712_10735331 3300025961 Bacteria 863
56 Ga0207668_10275703 3300025972 Bacteria 1377
57 Ga0207658_10160496 3300025986 Bacteria 1842
58 Ga0207677_10000343 3300026023 Bacteria 33031
59 Ga0207703_10000169 3300026035 Bacteria 76131
60 Ga0207703_10000704 3300026035 Bacteria 33055
61 Ga0207639_10009482 3300026041 Bacteria 6718
62 Ga0207639_10207172 3300026041 Bacteria 1686
63 Ga0207702_10002325 3300026078 Bacteria 18164
64 Ga0207674_10227522 3300026116 Bacteria 1813
65 Ga0207683_10148249 3300026121 Bacteria 2117
66 Ga0268266_10000045 3300028379 Bacteria 312955
67 Ga0268266_10033828 3300028379 Bacteria 4344
68 Ga0316579_10271521 3300031691 Bacteria 820
69 Ga0316578_10354607 3300031728 Bacteria 873
70 Ga0307415_100016703 3300032126 Bacteria 4382
71 Ga0316583_10105652 3300032133 Bacteria 981
72 Ga0373935_1145828 3300035692 Bacteria 579
73 Ga0451853_3136771 3300041512 Bacteria 1414
74 Ga0466967_0000006 3300045976 Bacteria 144065
75 Ga0495603_0002227 3300046455 Bacteria 11397
76 Ga0495629_0003072 3300046459 Bacteria 12684
77 Ga0495629_0004716 3300046459 Bacteria 10215
78 Ga0495638_0092453 3300046460 Bacteria 1821
79 Ga0495641_0000014 3300046461 Bacteria 140908
80 Ga0495641_0195125 3300046461 Bacteria 907
81 Ga0495653_0037751 3300046463 Bacteria 3793
82 Ga0495653_0100852 3300046463 Bacteria 2092
83 Ga0495662_0005247 3300046476 Bacteria 6495
84 Ga0495664_0078754 3300046477 Bacteria 1974
85 Ga0495664_0138331 3300046477 Bacteria 1476
86 Ga0495608_0000035 3300046511 Bacteria 133011
87 Ga0495608_0072825 3300046511 Bacteria 2241
88 Ga0495618_0631152 3300046514 Bacteria 635
89 Ga0495620_0002920 3300046515 Bacteria 9818
90 Ga0495628_0039933 3300046516 Bacteria 3752
91 Ga0495628_0050408 3300046516 Bacteria 3293
92 Ga0495630_0000060 3300046517 Bacteria 90021
93 Ga0495630_0006526 3300046517 Bacteria 8308
94 Ga0495643_0182656 3300046522 Bacteria 1018
95 Ga0495652_0383515 3300046529 Bacteria 999
96 Ga0495645_0577177 3300046543 Bacteria 694
97 Ga0495667_0000258 3300046559 Bacteria 34340
98 Ga0495625_0783470 3300046660 Bacteria 556
99 Ga0495635_0122945 3300046663 Bacteria 1770
100 Ga0495657_0000026 3300046675 Bacteria 133011
101 Ga0495599_0008366 3300046678 Bacteria 6287
102 Ga0495623_0291068 3300046679 Bacteria 905
103 Ga0495646_0435557 3300046680 Bacteria 678
104 Ga0495647_0000023 3300046681 Bacteria 67025
105 Ga0495647_0000744 3300046681 Bacteria 9671
106 Ga0495624_0001926 3300046690 Bacteria 15801
107 Ga0495649_0003071 3300046694 Bacteria 11425
108 Ga0495600_0034238 3300046809 Bacteria 3297
109 Ga0495600_0187233 3300046809 Bacteria 1332
110 Ga0495660_0111932 3300046810 Bacteria 1392
111 Ga0495674_0000010 3300047319 Bacteria 285794
112 Ga0495674_0311973 3300047319 Bacteria 1283
113 Ga0495676_0081713 3300047321 Bacteria 2448
114 Ga0495680_0003619 3300047322 Bacteria 15122
115 Ga0495680_0011360 3300047322 Bacteria 7886
116 Ga0495675_0000015 3300047444 Bacteria 133004
117 Ga0495675_0051342 3300047444 Bacteria 2619
118 Ga0495686_0060650 3300047472 Bacteria 2351
119 Ga0495602_0431887 3300048088 Bacteria 933
120 Ga0495602_0649689 3300048088 Bacteria 720
121 Ga0495602_0836804 3300048088 Bacteria 616
122 Ga0495614_0159011 3300048089 Bacteria 1010
123 Ga0496100_0000010 3300048903 Bacteria 205204
124 Ga0496101_0000025 3300048904 Bacteria 205204
125 Ga0496104_0000015 3300048907 Bacteria 374530
126 Ga0496104_0000024 3300048907 Bacteria 229913
127 Ga0496105_0000004 3300048908 Bacteria 475798
128 Ga0496105_0000013 3300048908 Bacteria 229894
129 Ga0496106_0000012 3300048909 Bacteria 205158
130 Ga0496107_0000010 3300048910 Bacteria 205188
131 Ga0496108_0000232 3300048911 Bacteria 49846
132 Ga0496108_0010260 3300048911 Bacteria 7604
133 Ga0496108_0934602 3300048911 Bacteria 743
134 Ga0496109_0000044 3300048912 Bacteria 133779
135 Ga0496109_0000462 3300048912 Bacteria 34785
136 Ga0496110_0016615 3300048913 Bacteria 6146
137 Ga0496110_0045691 3300048913 Bacteria 3829
138 Ga0496110_0198359 3300048913 Bacteria 1823
139 Ga0496111_0013646 3300048914 Bacteria 5535
140 Ga0496112_0136971 3300048915 Bacteria 2418
141 Ga0496113_0716221 3300048916 Bacteria 798
142 Ga0496114_0000056 3300048917 Bacteria 95692
143 Ga0496115_0000031 3300048918 Bacteria 138258
144 Ga0496120_0016516 3300048923 Bacteria 4825
145 Ga0496124_0197841 3300048927 Bacteria 1531
146 Ga0501042_0074187 3300049578 Bacteria 2434
147 Ga0501047_0596819 3300049581 Bacteria 926
148 Ga0501048_1074937 3300049582 Bacteria 579
149 Ga0501070_0049076 3300049586 Bacteria 3505
150 Ga0501080_0666959 3300049742 Bacteria 919
151 Ga0501081_0684307 3300049743 Bacteria 770
152 nmdc:mga08x19_998966_c1 3300050514 Bacteria 594
153 nmdc:mga0a205_7810_c1 3300050515 Bacteria 9715
154 Ga0495601_0000057 3300053077 Bacteria 61510
155 Ga0495601_0002292 3300053077 Bacteria 10795
156 Ga0495601_0104056 3300053077 Bacteria 1835
157 Ga0495612_0000031 3300053078 Bacteria 80955
158 Ga0495612_0005283 3300053078 Bacteria 5335
159 Ga0495612_0012018 3300053078 Bacteria 3488
160 Ga0495612_0132638 3300053078 Bacteria 1077
161 Ga0495595_0000017 3300053084 Bacteria 133011
162 Ga0495619_0001050 3300053085 Bacteria 18097
163 Ga0500566_0000943 3300053094 Bacteria 16679
164 Ga0500614_000630 3300053123 Bacteria 8976
165 Ga0501082_0696971 3300060353 Bacteria 889
166 Ga0530510_0186047 3300061734 Bacteria 1541

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_101146888 Ga0070675_1011468882 119
2 3300049582 Ga0501048_1074937 Ga0501048_1074937_174_536 119
3 3300005333 Ga0070677_10000082 Ga0070677_1000008217 120
4 3300005334 Ga0068869_100935445 Ga0068869_1009354451 120
5 3300025893 Ga0207682_10000018 Ga0207682_1000001813 120
6 3300002239 JGI24034J26672_10000172 JGI24034J26672_100001727 121
7 3300002244 JGI24742J22300_10001057 JGI24742J22300_100010576 121
8 3300005327 Ga0070658_10670598 Ga0070658_106705981 121
9 3300005329 Ga0070683_100072876 Ga0070683_1000728764 121
10 3300005337 Ga0070682_100000030 Ga0070682_1000000305 121
11 3300005338 Ga0068868_100000033 Ga0068868_10000003344 121
12 3300005340 Ga0070689_100067986 Ga0070689_1000679861 121
13 3300005341 Ga0070691_10000036 Ga0070691_1000003622 121
14 3300005345 Ga0070692_10092949 Ga0070692_100929492 121
15 3300005365 Ga0070688_100000016 Ga0070688_10000001615 121
16 3300005367 Ga0070667_100195163 Ga0070667_1001951632 121
17 3300005436 Ga0070713_100000058 Ga0070713_10000005816 121
18 3300005436 Ga0070713_100349890 Ga0070713_1003498902 121
19 3300005439 Ga0070711_100810447 Ga0070711_1008104472 121
20 3300005441 Ga0070700_100721720 Ga0070700_1007217201 121
21 3300005456 Ga0070678_100285711 Ga0070678_1002857112 121
22 3300005458 Ga0070681_10034036 Ga0070681_100340367 121
23 3300005466 Ga0070685_10000053 Ga0070685_1000005323 121
24 3300005530 Ga0070679_100005540 Ga0070679_10000554010 121
25 3300005535 Ga0070684_100035744 Ga0070684_1000357448 121
26 3300005539 Ga0068853_100013254 Ga0068853_1000132548 121
27 3300005548 Ga0070665_100000040 Ga0070665_100000040175 121
28 3300005548 Ga0070665_100240355 Ga0070665_1002403552 121
29 3300005563 Ga0068855_101443636 Ga0068855_1014436362 121
30 3300005577 Ga0068857_100692480 Ga0068857_1006924802 121
31 3300005614 Ga0068856_100003571 Ga0068856_10000357113 121
32 3300005615 Ga0070702_100020017 Ga0070702_1000200175 121
33 3300005834 Ga0068851_10052354 Ga0068851_100523541 121
34 3300005842 Ga0068858_100000069 Ga0068858_10000006937 121
35 3300005842 Ga0068858_100000156 Ga0068858_10000015628 121
36 3300005983 Ga0081540_1050979 Ga0081540_10509793 121
37 3300009551 Ga0105238_10000009 Ga0105238_10000009134 121
38 3300009553 Ga0105249_10999320 Ga0105249_109993202 121
39 3300013297 Ga0157378_10026980 Ga0157378_100269802 121
40 3300013306 Ga0163162_10355900 Ga0163162_103559001 121
41 3300013306 Ga0163162_10897479 Ga0163162_108974792 121
42 3300013308 Ga0157375_10000584 Ga0157375_1000058413 121
43 3300013308 Ga0157375_11161209 Ga0157375_111612092 121
44 3300020070 Ga0206356_11904470 Ga0206356_119044702 121
45 3300025321 Ga0207656_10032190 Ga0207656_100321902 121
46 3300025900 Ga0207710_10017816 Ga0207710_100178164 121
47 3300025905 Ga0207685_10079166 Ga0207685_100791662 121
48 3300025909 Ga0207705_10272239 Ga0207705_102722392 121
49 3300025916 Ga0207663_10427495 Ga0207663_104274952 121
50 3300025924 Ga0207694_10000004 Ga0207694_10000004161 121
51 3300025927 Ga0207687_10001695 Ga0207687_100016951 121
52 3300025928 Ga0207700_10000003 Ga0207700_10000003476 121
53 3300025928 Ga0207700_10163598 Ga0207700_101635982 121
54 3300025936 Ga0207670_10043523 Ga0207670_100435231 121
55 3300025944 Ga0207661_10052100 Ga0207661_100521004 121
56 3300025961 Ga0207712_10735331 Ga0207712_107353312 121
57 3300025972 Ga0207668_10275703 Ga0207668_102757032 121
58 3300025986 Ga0207658_10160496 Ga0207658_101604962 121
59 3300026023 Ga0207677_10000343 Ga0207677_1000034329 121
60 3300026035 Ga0207703_10000169 Ga0207703_1000016911 121
61 3300026035 Ga0207703_10000704 Ga0207703_1000070417 121
62 3300026041 Ga0207639_10009482 Ga0207639_100094824 121
63 3300026041 Ga0207639_10207172 Ga0207639_102071722 121
64 3300026078 Ga0207702_10002325 Ga0207702_1000232515 121
65 3300026116 Ga0207674_10227522 Ga0207674_102275223 121
66 3300026121 Ga0207683_10148249 Ga0207683_101482492 121
67 3300028379 Ga0268266_10000045 Ga0268266_10000045177 121
68 3300028379 Ga0268266_10033828 Ga0268266_100338286 121
69 3300031691 Ga0316579_10271521 Ga0316579_102715211 121
70 3300031728 Ga0316578_10354607 Ga0316578_103546072 121
71 3300032126 Ga0307415_100016703 Ga0307415_1000167033 121
72 3300032133 Ga0316583_10105652 Ga0316583_101056522 121
73 3300035692 Ga0373935_1145828 Ga0373935_1145828_62_427 121
74 3300041512 Ga0451853_3136771 Ga0451853_3136771_444_809 121
75 3300045976 Ga0466967_0000006 Ga0466967_0000006_71506_71871 121
76 3300046455 Ga0495603_0002227 Ga0495603_0002227_6279_6644 121
77 3300046459 Ga0495629_0003072 Ga0495629_0003072_3528_3893 121
78 3300046459 Ga0495629_0004716 Ga0495629_0004716_666_1031 121
79 3300046460 Ga0495638_0092453 Ga0495638_0092453_482_847 121
80 3300046461 Ga0495641_0000014 Ga0495641_0000014_1682_2047 121
81 3300046461 Ga0495641_0195125 Ga0495641_0195125_69_434 121
82 3300046463 Ga0495653_0037751 Ga0495653_0037751_2493_2858 121
83 3300046463 Ga0495653_0100852 Ga0495653_0100852_804_1169 121
84 3300046476 Ga0495662_0005247 Ga0495662_0005247_1555_1920 121
85 3300046477 Ga0495664_0078754 Ga0495664_0078754_1354_1719 121
86 3300046477 Ga0495664_0138331 Ga0495664_0138331_102_467 121
87 3300046511 Ga0495608_0000035 Ga0495608_0000035_7730_8095 121
88 3300046511 Ga0495608_0072825 Ga0495608_0072825_1153_1518 121
89 3300046514 Ga0495618_0631152 Ga0495618_0631152_157_522 121
90 3300046515 Ga0495620_0002920 Ga0495620_0002920_748_1113 121
91 3300046516 Ga0495628_0039933 Ga0495628_0039933_2181_2546 121
92 3300046516 Ga0495628_0050408 Ga0495628_0050408_515_880 121
93 3300046517 Ga0495630_0000060 Ga0495630_0000060_80257_80622 121
94 3300046517 Ga0495630_0006526 Ga0495630_0006526_2699_3064 121
95 3300046522 Ga0495643_0182656 Ga0495643_0182656_533_898 121
96 3300046529 Ga0495652_0383515 Ga0495652_0383515_57_422 121
97 3300046543 Ga0495645_0577177 Ga0495645_0577177_282_647 121
98 3300046559 Ga0495667_0000258 Ga0495667_0000258_25471_25836 121
99 3300046660 Ga0495625_0783470 Ga0495625_0783470_53_418 121
100 3300046663 Ga0495635_0122945 Ga0495635_0122945_480_845 121
101 3300046675 Ga0495657_0000026 Ga0495657_0000026_124917_125282 121
102 3300046678 Ga0495599_0008366 Ga0495599_0008366_835_1200 121
103 3300046679 Ga0495623_0291068 Ga0495623_0291068_104_469 121
104 3300046680 Ga0495646_0435557 Ga0495646_0435557_81_446 121
105 3300046681 Ga0495647_0000023 Ga0495647_0000023_55839_56204 121
106 3300046681 Ga0495647_0000744 Ga0495647_0000744_1816_2181 121
107 3300046690 Ga0495624_0001926 Ga0495624_0001926_6627_6992 121
108 3300046694 Ga0495649_0003071 Ga0495649_0003071_9597_9962 121
109 3300046809 Ga0495600_0034238 Ga0495600_0034238_1213_1578 121
110 3300046809 Ga0495600_0187233 Ga0495600_0187233_864_1229 121
111 3300046810 Ga0495660_0111932 Ga0495660_0111932_69_434 121
112 3300047319 Ga0495674_0000010 Ga0495674_0000010_164264_164629 121
113 3300047319 Ga0495674_0311973 Ga0495674_0311973_700_1065 121
114 3300047321 Ga0495676_0081713 Ga0495676_0081713_1418_1783 121
115 3300047322 Ga0495680_0003619 Ga0495680_0003619_7866_8231 121
116 3300047322 Ga0495680_0011360 Ga0495680_0011360_2947_3312 121
117 3300047444 Ga0495675_0000015 Ga0495675_0000015_124910_125275 121
118 3300047444 Ga0495675_0051342 Ga0495675_0051342_1413_1778 121
119 3300047472 Ga0495686_0060650 Ga0495686_0060650_1659_2024 121
120 3300048088 Ga0495602_0431887 Ga0495602_0431887_417_782 121
121 3300048088 Ga0495602_0649689 Ga0495602_0649689_221_586 121
122 3300048088 Ga0495602_0836804 Ga0495602_0836804_230_595 121
123 3300048089 Ga0495614_0159011 Ga0495614_0159011_276_641 121
124 3300048903 Ga0496100_0000010 Ga0496100_0000010_10027_10392 121
125 3300048904 Ga0496101_0000025 Ga0496101_0000025_10027_10392 121
126 3300048907 Ga0496104_0000015 Ga0496104_0000015_22643_23008 121
127 3300048907 Ga0496104_0000024 Ga0496104_0000024_182409_182810 121
128 3300048908 Ga0496105_0000004 Ga0496105_0000004_452791_453156 121
129 3300048908 Ga0496105_0000013 Ga0496105_0000013_47104_47505 121
130 3300048909 Ga0496106_0000012 Ga0496106_0000012_194785_195150 121
131 3300048910 Ga0496107_0000010 Ga0496107_0000010_194797_195162 121
132 3300048911 Ga0496108_0000232 Ga0496108_0000232_37751_38116 121
133 3300048911 Ga0496108_0010260 Ga0496108_0010260_745_1110 121
134 3300048911 Ga0496108_0934602 Ga0496108_0934602_129_494 121
135 3300048912 Ga0496109_0000044 Ga0496109_0000044_121659_122024 121
136 3300048912 Ga0496109_0000462 Ga0496109_0000462_6627_6992 121
137 3300048913 Ga0496110_0016615 Ga0496110_0016615_266_679 121
138 3300048913 Ga0496110_0045691 Ga0496110_0045691_1742_2107 121
139 3300048913 Ga0496110_0198359 Ga0496110_0198359_1149_1514 121
140 3300048914 Ga0496111_0013646 Ga0496111_0013646_3722_4087 121
141 3300048915 Ga0496112_0136971 Ga0496112_0136971_1473_1838 121
142 3300048916 Ga0496113_0716221 Ga0496113_0716221_197_562 121
143 3300048917 Ga0496114_0000056 Ga0496114_0000056_11401_11766 121
144 3300048918 Ga0496115_0000031 Ga0496115_0000031_8768_9226 121
145 3300048923 Ga0496120_0016516 Ga0496120_0016516_2963_3328 121
146 3300048927 Ga0496124_0197841 Ga0496124_0197841_698_1063 121
147 3300049578 Ga0501042_0074187 Ga0501042_0074187_636_1001 121
148 3300049581 Ga0501047_0596819 Ga0501047_0596819_112_477 121
149 3300049586 Ga0501070_0049076 Ga0501070_0049076_2339_2704 121
150 3300049742 Ga0501080_0666959 Ga0501080_0666959_357_722 121
151 3300049743 Ga0501081_0684307 Ga0501081_0684307_206_670 121
152 3300050514 nmdc:mga08x19_998966_c1 nmdc:mga08x19_998966_c1_160_525 121
153 3300050515 nmdc:mga0a205_7810_c1 nmdc:mga0a205_7810_c1_1307_1732 121
154 3300053077 Ga0495601_0000057 Ga0495601_0000057_11577_11951 121
155 3300053077 Ga0495601_0002292 Ga0495601_0002292_3682_4047 121
156 3300053077 Ga0495601_0104056 Ga0495601_0104056_823_1188 121
157 3300053078 Ga0495612_0000031 Ga0495612_0000031_19185_19550 121
158 3300053078 Ga0495612_0005283 Ga0495612_0005283_4337_4702 121
159 3300053078 Ga0495612_0012018 Ga0495612_0012018_105_470 121
160 3300053078 Ga0495612_0132638 Ga0495612_0132638_328_696 121
161 3300053084 Ga0495595_0000017 Ga0495595_0000017_124917_125282 121
162 3300053085 Ga0495619_0001050 Ga0495619_0001050_10003_10368 121
163 3300053094 Ga0500566_0000943 Ga0500566_0000943_8204_8569 121
164 3300053123 Ga0500614_000630 Ga0500614_000630_6812_7177 121
165 3300060353 Ga0501082_0696971 Ga0501082_0696971_264_641 121
166 3300061734 Ga0530510_0186047 Ga0530510_0186047_252_629 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02130

YbeY

Endoribonuclease YbeY

28

133

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.7985 3 120
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.7826 2 120
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.7743 3 120
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.7649 2 120
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.7599 2 120
ID Description Score Start End Superfamily
af_A0A0R0GDI7_137_270_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8909 30 120 3.40.390.30
af_P9WGX9_1_163_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.826 1 119 3.40.390.30
af_Q4DNU0_12_187_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8178 11 120 3.40.390.30
af_P9WGX9_1_163_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8066 1 119 3.40.390.30
1oz9A00 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.7985 3 120 3.40.390.30
ID Description Score Start End GO Terms
AF-A0A7W0LQ38-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9759 3 121 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A7W0H5P1-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9714 3 119 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A537YV18-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9695 1 121 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A6J7CQH1-F1-model_v4 Unannotated protein 0.9637 3 121 GO:0004222
GO:0004519
GO:0006364
GO:0046872
AF-A0A7V9M6D9-F1-model_v4 rRNA maturation RNase YbeY 0.9635 12 121 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270

Feature Viewer

pLDDT pTM Quality
95.37 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map