F248565
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 166 | 131 | 166 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300025961|Ga0207712_10735331|Ga0207712_107353312 |
| Length | 150 |
| Sequence | VRRASGTRADAALLSLDLTDVPAGLRGPVAVALAATGVDDGHLAVELVDAARIRDLNRKHRGKDAPTDVLAFPIDETAPTAGPRELGDVAICPEHCSDVTEAAVHGVLHLCGYDHETDAGEMLALQREVMHSLETPPPPDAGARARGFRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 32 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 38 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 60 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 61 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 62 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 63 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 64 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 65 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 66 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 101 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 102 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 103 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 104 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 105 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 106 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 107 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 108 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 109 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 110 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 111 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 112 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 113 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 114 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 115 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 116 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 129 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 130 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.2 |
| Nodule | 0 |
| Rhizoplane | 12.65 |
| Rhizosphere | 84.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10000172 | 3300002239 | Bacteria | 8945 |
| 2 | JGI24742J22300_10001057 | 3300002244 | Bacteria | 4244 |
| 3 | Ga0070658_10670598 | 3300005327 | Bacteria | 900 |
| 4 | Ga0070683_100072876 | 3300005329 | Bacteria | 3207 |
| 5 | Ga0070677_10000082 | 3300005333 | Bacteria | 30305 |
| 6 | Ga0068869_100935445 | 3300005334 | Bacteria | 752 |
| 7 | Ga0070682_100000030 | 3300005337 | Bacteria | 182768 |
| 8 | Ga0068868_100000033 | 3300005338 | Bacteria | 75402 |
| 9 | Ga0070689_100067986 | 3300005340 | Bacteria | 2778 |
| 10 | Ga0070691_10000036 | 3300005341 | Bacteria | 38327 |
| 11 | Ga0070692_10092949 | 3300005345 | Bacteria | 1642 |
| 12 | Ga0070675_101146888 | 3300005354 | Bacteria | 715 |
| 13 | Ga0070688_100000016 | 3300005365 | Bacteria | 73740 |
| 14 | Ga0070667_100195163 | 3300005367 | Bacteria | 1795 |
| 15 | Ga0070713_100000058 | 3300005436 | Bacteria | 70009 |
| 16 | Ga0070713_100349890 | 3300005436 | Bacteria | 1371 |
| 17 | Ga0070711_100810447 | 3300005439 | Bacteria | 794 |
| 18 | Ga0070700_100721720 | 3300005441 | Bacteria | 795 |
| 19 | Ga0070678_100285711 | 3300005456 | Bacteria | 1397 |
| 20 | Ga0070681_10034036 | 3300005458 | Bacteria | 5117 |
| 21 | Ga0070685_10000053 | 3300005466 | Bacteria | 70868 |
| 22 | Ga0070679_100005540 | 3300005530 | Bacteria | 11698 |
| 23 | Ga0070684_100035744 | 3300005535 | Bacteria | 4254 |
| 24 | Ga0068853_100013254 | 3300005539 | Bacteria | 6730 |
| 25 | Ga0070665_100000040 | 3300005548 | Bacteria | 305480 |
| 26 | Ga0070665_100240355 | 3300005548 | Bacteria | 1812 |
| 27 | Ga0068855_101443636 | 3300005563 | Bacteria | 708 |
| 28 | Ga0068857_100692480 | 3300005577 | Bacteria | 968 |
| 29 | Ga0068856_100003571 | 3300005614 | Bacteria | 15652 |
| 30 | Ga0070702_100020017 | 3300005615 | Bacteria | 3500 |
| 31 | Ga0068851_10052354 | 3300005834 | Bacteria | 2076 |
| 32 | Ga0068858_100000069 | 3300005842 | Bacteria | 105617 |
| 33 | Ga0068858_100000156 | 3300005842 | Bacteria | 72781 |
| 34 | Ga0081540_1050979 | 3300005983 | Bacteria | 2050 |
| 35 | Ga0105238_10000009 | 3300009551 | Bacteria | 288729 |
| 36 | Ga0105249_10999320 | 3300009553 | Bacteria | 905 |
| 37 | Ga0157378_10026980 | 3300013297 | Bacteria | 5066 |
| 38 | Ga0163162_10355900 | 3300013306 | Bacteria | 1597 |
| 39 | Ga0163162_10897479 | 3300013306 | Bacteria | 1000 |
| 40 | Ga0157375_10000584 | 3300013308 | Bacteria | 32509 |
| 41 | Ga0157375_11161209 | 3300013308 | Bacteria | 905 |
| 42 | Ga0206356_11904470 | 3300020070 | Bacteria | 1022 |
| 43 | Ga0207656_10032190 | 3300025321 | Bacteria | 2177 |
| 44 | Ga0207682_10000018 | 3300025893 | Bacteria | 66215 |
| 45 | Ga0207710_10017816 | 3300025900 | Bacteria | 3014 |
| 46 | Ga0207685_10079166 | 3300025905 | Bacteria | 1355 |
| 47 | Ga0207705_10272239 | 3300025909 | Bacteria | 1295 |
| 48 | Ga0207663_10427495 | 3300025916 | Bacteria | 1018 |
| 49 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 50 | Ga0207687_10001695 | 3300025927 | Bacteria | 15197 |
| 51 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 52 | Ga0207700_10163598 | 3300025928 | Bacteria | 1850 |
| 53 | Ga0207670_10043523 | 3300025936 | Bacteria | 2966 |
| 54 | Ga0207661_10052100 | 3300025944 | Bacteria | 3268 |
| 55 | Ga0207712_10735331 | 3300025961 | Bacteria | 863 |
| 56 | Ga0207668_10275703 | 3300025972 | Bacteria | 1377 |
| 57 | Ga0207658_10160496 | 3300025986 | Bacteria | 1842 |
| 58 | Ga0207677_10000343 | 3300026023 | Bacteria | 33031 |
| 59 | Ga0207703_10000169 | 3300026035 | Bacteria | 76131 |
| 60 | Ga0207703_10000704 | 3300026035 | Bacteria | 33055 |
| 61 | Ga0207639_10009482 | 3300026041 | Bacteria | 6718 |
| 62 | Ga0207639_10207172 | 3300026041 | Bacteria | 1686 |
| 63 | Ga0207702_10002325 | 3300026078 | Bacteria | 18164 |
| 64 | Ga0207674_10227522 | 3300026116 | Bacteria | 1813 |
| 65 | Ga0207683_10148249 | 3300026121 | Bacteria | 2117 |
| 66 | Ga0268266_10000045 | 3300028379 | Bacteria | 312955 |
| 67 | Ga0268266_10033828 | 3300028379 | Bacteria | 4344 |
| 68 | Ga0316579_10271521 | 3300031691 | Bacteria | 820 |
| 69 | Ga0316578_10354607 | 3300031728 | Bacteria | 873 |
| 70 | Ga0307415_100016703 | 3300032126 | Bacteria | 4382 |
| 71 | Ga0316583_10105652 | 3300032133 | Bacteria | 981 |
| 72 | Ga0373935_1145828 | 3300035692 | Bacteria | 579 |
| 73 | Ga0451853_3136771 | 3300041512 | Bacteria | 1414 |
| 74 | Ga0466967_0000006 | 3300045976 | Bacteria | 144065 |
| 75 | Ga0495603_0002227 | 3300046455 | Bacteria | 11397 |
| 76 | Ga0495629_0003072 | 3300046459 | Bacteria | 12684 |
| 77 | Ga0495629_0004716 | 3300046459 | Bacteria | 10215 |
| 78 | Ga0495638_0092453 | 3300046460 | Bacteria | 1821 |
| 79 | Ga0495641_0000014 | 3300046461 | Bacteria | 140908 |
| 80 | Ga0495641_0195125 | 3300046461 | Bacteria | 907 |
| 81 | Ga0495653_0037751 | 3300046463 | Bacteria | 3793 |
| 82 | Ga0495653_0100852 | 3300046463 | Bacteria | 2092 |
| 83 | Ga0495662_0005247 | 3300046476 | Bacteria | 6495 |
| 84 | Ga0495664_0078754 | 3300046477 | Bacteria | 1974 |
| 85 | Ga0495664_0138331 | 3300046477 | Bacteria | 1476 |
| 86 | Ga0495608_0000035 | 3300046511 | Bacteria | 133011 |
| 87 | Ga0495608_0072825 | 3300046511 | Bacteria | 2241 |
| 88 | Ga0495618_0631152 | 3300046514 | Bacteria | 635 |
| 89 | Ga0495620_0002920 | 3300046515 | Bacteria | 9818 |
| 90 | Ga0495628_0039933 | 3300046516 | Bacteria | 3752 |
| 91 | Ga0495628_0050408 | 3300046516 | Bacteria | 3293 |
| 92 | Ga0495630_0000060 | 3300046517 | Bacteria | 90021 |
| 93 | Ga0495630_0006526 | 3300046517 | Bacteria | 8308 |
| 94 | Ga0495643_0182656 | 3300046522 | Bacteria | 1018 |
| 95 | Ga0495652_0383515 | 3300046529 | Bacteria | 999 |
| 96 | Ga0495645_0577177 | 3300046543 | Bacteria | 694 |
| 97 | Ga0495667_0000258 | 3300046559 | Bacteria | 34340 |
| 98 | Ga0495625_0783470 | 3300046660 | Bacteria | 556 |
| 99 | Ga0495635_0122945 | 3300046663 | Bacteria | 1770 |
| 100 | Ga0495657_0000026 | 3300046675 | Bacteria | 133011 |
| 101 | Ga0495599_0008366 | 3300046678 | Bacteria | 6287 |
| 102 | Ga0495623_0291068 | 3300046679 | Bacteria | 905 |
| 103 | Ga0495646_0435557 | 3300046680 | Bacteria | 678 |
| 104 | Ga0495647_0000023 | 3300046681 | Bacteria | 67025 |
| 105 | Ga0495647_0000744 | 3300046681 | Bacteria | 9671 |
| 106 | Ga0495624_0001926 | 3300046690 | Bacteria | 15801 |
| 107 | Ga0495649_0003071 | 3300046694 | Bacteria | 11425 |
| 108 | Ga0495600_0034238 | 3300046809 | Bacteria | 3297 |
| 109 | Ga0495600_0187233 | 3300046809 | Bacteria | 1332 |
| 110 | Ga0495660_0111932 | 3300046810 | Bacteria | 1392 |
| 111 | Ga0495674_0000010 | 3300047319 | Bacteria | 285794 |
| 112 | Ga0495674_0311973 | 3300047319 | Bacteria | 1283 |
| 113 | Ga0495676_0081713 | 3300047321 | Bacteria | 2448 |
| 114 | Ga0495680_0003619 | 3300047322 | Bacteria | 15122 |
| 115 | Ga0495680_0011360 | 3300047322 | Bacteria | 7886 |
| 116 | Ga0495675_0000015 | 3300047444 | Bacteria | 133004 |
| 117 | Ga0495675_0051342 | 3300047444 | Bacteria | 2619 |
| 118 | Ga0495686_0060650 | 3300047472 | Bacteria | 2351 |
| 119 | Ga0495602_0431887 | 3300048088 | Bacteria | 933 |
| 120 | Ga0495602_0649689 | 3300048088 | Bacteria | 720 |
| 121 | Ga0495602_0836804 | 3300048088 | Bacteria | 616 |
| 122 | Ga0495614_0159011 | 3300048089 | Bacteria | 1010 |
| 123 | Ga0496100_0000010 | 3300048903 | Bacteria | 205204 |
| 124 | Ga0496101_0000025 | 3300048904 | Bacteria | 205204 |
| 125 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 126 | Ga0496104_0000024 | 3300048907 | Bacteria | 229913 |
| 127 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 128 | Ga0496105_0000013 | 3300048908 | Bacteria | 229894 |
| 129 | Ga0496106_0000012 | 3300048909 | Bacteria | 205158 |
| 130 | Ga0496107_0000010 | 3300048910 | Bacteria | 205188 |
| 131 | Ga0496108_0000232 | 3300048911 | Bacteria | 49846 |
| 132 | Ga0496108_0010260 | 3300048911 | Bacteria | 7604 |
| 133 | Ga0496108_0934602 | 3300048911 | Bacteria | 743 |
| 134 | Ga0496109_0000044 | 3300048912 | Bacteria | 133779 |
| 135 | Ga0496109_0000462 | 3300048912 | Bacteria | 34785 |
| 136 | Ga0496110_0016615 | 3300048913 | Bacteria | 6146 |
| 137 | Ga0496110_0045691 | 3300048913 | Bacteria | 3829 |
| 138 | Ga0496110_0198359 | 3300048913 | Bacteria | 1823 |
| 139 | Ga0496111_0013646 | 3300048914 | Bacteria | 5535 |
| 140 | Ga0496112_0136971 | 3300048915 | Bacteria | 2418 |
| 141 | Ga0496113_0716221 | 3300048916 | Bacteria | 798 |
| 142 | Ga0496114_0000056 | 3300048917 | Bacteria | 95692 |
| 143 | Ga0496115_0000031 | 3300048918 | Bacteria | 138258 |
| 144 | Ga0496120_0016516 | 3300048923 | Bacteria | 4825 |
| 145 | Ga0496124_0197841 | 3300048927 | Bacteria | 1531 |
| 146 | Ga0501042_0074187 | 3300049578 | Bacteria | 2434 |
| 147 | Ga0501047_0596819 | 3300049581 | Bacteria | 926 |
| 148 | Ga0501048_1074937 | 3300049582 | Bacteria | 579 |
| 149 | Ga0501070_0049076 | 3300049586 | Bacteria | 3505 |
| 150 | Ga0501080_0666959 | 3300049742 | Bacteria | 919 |
| 151 | Ga0501081_0684307 | 3300049743 | Bacteria | 770 |
| 152 | nmdc:mga08x19_998966_c1 | 3300050514 | Bacteria | 594 |
| 153 | nmdc:mga0a205_7810_c1 | 3300050515 | Bacteria | 9715 |
| 154 | Ga0495601_0000057 | 3300053077 | Bacteria | 61510 |
| 155 | Ga0495601_0002292 | 3300053077 | Bacteria | 10795 |
| 156 | Ga0495601_0104056 | 3300053077 | Bacteria | 1835 |
| 157 | Ga0495612_0000031 | 3300053078 | Bacteria | 80955 |
| 158 | Ga0495612_0005283 | 3300053078 | Bacteria | 5335 |
| 159 | Ga0495612_0012018 | 3300053078 | Bacteria | 3488 |
| 160 | Ga0495612_0132638 | 3300053078 | Bacteria | 1077 |
| 161 | Ga0495595_0000017 | 3300053084 | Bacteria | 133011 |
| 162 | Ga0495619_0001050 | 3300053085 | Bacteria | 18097 |
| 163 | Ga0500566_0000943 | 3300053094 | Bacteria | 16679 |
| 164 | Ga0500614_000630 | 3300053123 | Bacteria | 8976 |
| 165 | Ga0501082_0696971 | 3300060353 | Bacteria | 889 |
| 166 | Ga0530510_0186047 | 3300061734 | Bacteria | 1541 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005354 | Ga0070675_101146888 | Ga0070675_1011468882 | 119 |
| 2 | 3300049582 | Ga0501048_1074937 | Ga0501048_1074937_174_536 | 119 |
| 3 | 3300005333 | Ga0070677_10000082 | Ga0070677_1000008217 | 120 |
| 4 | 3300005334 | Ga0068869_100935445 | Ga0068869_1009354451 | 120 |
| 5 | 3300025893 | Ga0207682_10000018 | Ga0207682_1000001813 | 120 |
| 6 | 3300002239 | JGI24034J26672_10000172 | JGI24034J26672_100001727 | 121 |
| 7 | 3300002244 | JGI24742J22300_10001057 | JGI24742J22300_100010576 | 121 |
| 8 | 3300005327 | Ga0070658_10670598 | Ga0070658_106705981 | 121 |
| 9 | 3300005329 | Ga0070683_100072876 | Ga0070683_1000728764 | 121 |
| 10 | 3300005337 | Ga0070682_100000030 | Ga0070682_1000000305 | 121 |
| 11 | 3300005338 | Ga0068868_100000033 | Ga0068868_10000003344 | 121 |
| 12 | 3300005340 | Ga0070689_100067986 | Ga0070689_1000679861 | 121 |
| 13 | 3300005341 | Ga0070691_10000036 | Ga0070691_1000003622 | 121 |
| 14 | 3300005345 | Ga0070692_10092949 | Ga0070692_100929492 | 121 |
| 15 | 3300005365 | Ga0070688_100000016 | Ga0070688_10000001615 | 121 |
| 16 | 3300005367 | Ga0070667_100195163 | Ga0070667_1001951632 | 121 |
| 17 | 3300005436 | Ga0070713_100000058 | Ga0070713_10000005816 | 121 |
| 18 | 3300005436 | Ga0070713_100349890 | Ga0070713_1003498902 | 121 |
| 19 | 3300005439 | Ga0070711_100810447 | Ga0070711_1008104472 | 121 |
| 20 | 3300005441 | Ga0070700_100721720 | Ga0070700_1007217201 | 121 |
| 21 | 3300005456 | Ga0070678_100285711 | Ga0070678_1002857112 | 121 |
| 22 | 3300005458 | Ga0070681_10034036 | Ga0070681_100340367 | 121 |
| 23 | 3300005466 | Ga0070685_10000053 | Ga0070685_1000005323 | 121 |
| 24 | 3300005530 | Ga0070679_100005540 | Ga0070679_10000554010 | 121 |
| 25 | 3300005535 | Ga0070684_100035744 | Ga0070684_1000357448 | 121 |
| 26 | 3300005539 | Ga0068853_100013254 | Ga0068853_1000132548 | 121 |
| 27 | 3300005548 | Ga0070665_100000040 | Ga0070665_100000040175 | 121 |
| 28 | 3300005548 | Ga0070665_100240355 | Ga0070665_1002403552 | 121 |
| 29 | 3300005563 | Ga0068855_101443636 | Ga0068855_1014436362 | 121 |
| 30 | 3300005577 | Ga0068857_100692480 | Ga0068857_1006924802 | 121 |
| 31 | 3300005614 | Ga0068856_100003571 | Ga0068856_10000357113 | 121 |
| 32 | 3300005615 | Ga0070702_100020017 | Ga0070702_1000200175 | 121 |
| 33 | 3300005834 | Ga0068851_10052354 | Ga0068851_100523541 | 121 |
| 34 | 3300005842 | Ga0068858_100000069 | Ga0068858_10000006937 | 121 |
| 35 | 3300005842 | Ga0068858_100000156 | Ga0068858_10000015628 | 121 |
| 36 | 3300005983 | Ga0081540_1050979 | Ga0081540_10509793 | 121 |
| 37 | 3300009551 | Ga0105238_10000009 | Ga0105238_10000009134 | 121 |
| 38 | 3300009553 | Ga0105249_10999320 | Ga0105249_109993202 | 121 |
| 39 | 3300013297 | Ga0157378_10026980 | Ga0157378_100269802 | 121 |
| 40 | 3300013306 | Ga0163162_10355900 | Ga0163162_103559001 | 121 |
| 41 | 3300013306 | Ga0163162_10897479 | Ga0163162_108974792 | 121 |
| 42 | 3300013308 | Ga0157375_10000584 | Ga0157375_1000058413 | 121 |
| 43 | 3300013308 | Ga0157375_11161209 | Ga0157375_111612092 | 121 |
| 44 | 3300020070 | Ga0206356_11904470 | Ga0206356_119044702 | 121 |
| 45 | 3300025321 | Ga0207656_10032190 | Ga0207656_100321902 | 121 |
| 46 | 3300025900 | Ga0207710_10017816 | Ga0207710_100178164 | 121 |
| 47 | 3300025905 | Ga0207685_10079166 | Ga0207685_100791662 | 121 |
| 48 | 3300025909 | Ga0207705_10272239 | Ga0207705_102722392 | 121 |
| 49 | 3300025916 | Ga0207663_10427495 | Ga0207663_104274952 | 121 |
| 50 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004161 | 121 |
| 51 | 3300025927 | Ga0207687_10001695 | Ga0207687_100016951 | 121 |
| 52 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003476 | 121 |
| 53 | 3300025928 | Ga0207700_10163598 | Ga0207700_101635982 | 121 |
| 54 | 3300025936 | Ga0207670_10043523 | Ga0207670_100435231 | 121 |
| 55 | 3300025944 | Ga0207661_10052100 | Ga0207661_100521004 | 121 |
| 56 | 3300025961 | Ga0207712_10735331 | Ga0207712_107353312 | 121 |
| 57 | 3300025972 | Ga0207668_10275703 | Ga0207668_102757032 | 121 |
| 58 | 3300025986 | Ga0207658_10160496 | Ga0207658_101604962 | 121 |
| 59 | 3300026023 | Ga0207677_10000343 | Ga0207677_1000034329 | 121 |
| 60 | 3300026035 | Ga0207703_10000169 | Ga0207703_1000016911 | 121 |
| 61 | 3300026035 | Ga0207703_10000704 | Ga0207703_1000070417 | 121 |
| 62 | 3300026041 | Ga0207639_10009482 | Ga0207639_100094824 | 121 |
| 63 | 3300026041 | Ga0207639_10207172 | Ga0207639_102071722 | 121 |
| 64 | 3300026078 | Ga0207702_10002325 | Ga0207702_1000232515 | 121 |
| 65 | 3300026116 | Ga0207674_10227522 | Ga0207674_102275223 | 121 |
| 66 | 3300026121 | Ga0207683_10148249 | Ga0207683_101482492 | 121 |
| 67 | 3300028379 | Ga0268266_10000045 | Ga0268266_10000045177 | 121 |
| 68 | 3300028379 | Ga0268266_10033828 | Ga0268266_100338286 | 121 |
| 69 | 3300031691 | Ga0316579_10271521 | Ga0316579_102715211 | 121 |
| 70 | 3300031728 | Ga0316578_10354607 | Ga0316578_103546072 | 121 |
| 71 | 3300032126 | Ga0307415_100016703 | Ga0307415_1000167033 | 121 |
| 72 | 3300032133 | Ga0316583_10105652 | Ga0316583_101056522 | 121 |
| 73 | 3300035692 | Ga0373935_1145828 | Ga0373935_1145828_62_427 | 121 |
| 74 | 3300041512 | Ga0451853_3136771 | Ga0451853_3136771_444_809 | 121 |
| 75 | 3300045976 | Ga0466967_0000006 | Ga0466967_0000006_71506_71871 | 121 |
| 76 | 3300046455 | Ga0495603_0002227 | Ga0495603_0002227_6279_6644 | 121 |
| 77 | 3300046459 | Ga0495629_0003072 | Ga0495629_0003072_3528_3893 | 121 |
| 78 | 3300046459 | Ga0495629_0004716 | Ga0495629_0004716_666_1031 | 121 |
| 79 | 3300046460 | Ga0495638_0092453 | Ga0495638_0092453_482_847 | 121 |
| 80 | 3300046461 | Ga0495641_0000014 | Ga0495641_0000014_1682_2047 | 121 |
| 81 | 3300046461 | Ga0495641_0195125 | Ga0495641_0195125_69_434 | 121 |
| 82 | 3300046463 | Ga0495653_0037751 | Ga0495653_0037751_2493_2858 | 121 |
| 83 | 3300046463 | Ga0495653_0100852 | Ga0495653_0100852_804_1169 | 121 |
| 84 | 3300046476 | Ga0495662_0005247 | Ga0495662_0005247_1555_1920 | 121 |
| 85 | 3300046477 | Ga0495664_0078754 | Ga0495664_0078754_1354_1719 | 121 |
| 86 | 3300046477 | Ga0495664_0138331 | Ga0495664_0138331_102_467 | 121 |
| 87 | 3300046511 | Ga0495608_0000035 | Ga0495608_0000035_7730_8095 | 121 |
| 88 | 3300046511 | Ga0495608_0072825 | Ga0495608_0072825_1153_1518 | 121 |
| 89 | 3300046514 | Ga0495618_0631152 | Ga0495618_0631152_157_522 | 121 |
| 90 | 3300046515 | Ga0495620_0002920 | Ga0495620_0002920_748_1113 | 121 |
| 91 | 3300046516 | Ga0495628_0039933 | Ga0495628_0039933_2181_2546 | 121 |
| 92 | 3300046516 | Ga0495628_0050408 | Ga0495628_0050408_515_880 | 121 |
| 93 | 3300046517 | Ga0495630_0000060 | Ga0495630_0000060_80257_80622 | 121 |
| 94 | 3300046517 | Ga0495630_0006526 | Ga0495630_0006526_2699_3064 | 121 |
| 95 | 3300046522 | Ga0495643_0182656 | Ga0495643_0182656_533_898 | 121 |
| 96 | 3300046529 | Ga0495652_0383515 | Ga0495652_0383515_57_422 | 121 |
| 97 | 3300046543 | Ga0495645_0577177 | Ga0495645_0577177_282_647 | 121 |
| 98 | 3300046559 | Ga0495667_0000258 | Ga0495667_0000258_25471_25836 | 121 |
| 99 | 3300046660 | Ga0495625_0783470 | Ga0495625_0783470_53_418 | 121 |
| 100 | 3300046663 | Ga0495635_0122945 | Ga0495635_0122945_480_845 | 121 |
| 101 | 3300046675 | Ga0495657_0000026 | Ga0495657_0000026_124917_125282 | 121 |
| 102 | 3300046678 | Ga0495599_0008366 | Ga0495599_0008366_835_1200 | 121 |
| 103 | 3300046679 | Ga0495623_0291068 | Ga0495623_0291068_104_469 | 121 |
| 104 | 3300046680 | Ga0495646_0435557 | Ga0495646_0435557_81_446 | 121 |
| 105 | 3300046681 | Ga0495647_0000023 | Ga0495647_0000023_55839_56204 | 121 |
| 106 | 3300046681 | Ga0495647_0000744 | Ga0495647_0000744_1816_2181 | 121 |
| 107 | 3300046690 | Ga0495624_0001926 | Ga0495624_0001926_6627_6992 | 121 |
| 108 | 3300046694 | Ga0495649_0003071 | Ga0495649_0003071_9597_9962 | 121 |
| 109 | 3300046809 | Ga0495600_0034238 | Ga0495600_0034238_1213_1578 | 121 |
| 110 | 3300046809 | Ga0495600_0187233 | Ga0495600_0187233_864_1229 | 121 |
| 111 | 3300046810 | Ga0495660_0111932 | Ga0495660_0111932_69_434 | 121 |
| 112 | 3300047319 | Ga0495674_0000010 | Ga0495674_0000010_164264_164629 | 121 |
| 113 | 3300047319 | Ga0495674_0311973 | Ga0495674_0311973_700_1065 | 121 |
| 114 | 3300047321 | Ga0495676_0081713 | Ga0495676_0081713_1418_1783 | 121 |
| 115 | 3300047322 | Ga0495680_0003619 | Ga0495680_0003619_7866_8231 | 121 |
| 116 | 3300047322 | Ga0495680_0011360 | Ga0495680_0011360_2947_3312 | 121 |
| 117 | 3300047444 | Ga0495675_0000015 | Ga0495675_0000015_124910_125275 | 121 |
| 118 | 3300047444 | Ga0495675_0051342 | Ga0495675_0051342_1413_1778 | 121 |
| 119 | 3300047472 | Ga0495686_0060650 | Ga0495686_0060650_1659_2024 | 121 |
| 120 | 3300048088 | Ga0495602_0431887 | Ga0495602_0431887_417_782 | 121 |
| 121 | 3300048088 | Ga0495602_0649689 | Ga0495602_0649689_221_586 | 121 |
| 122 | 3300048088 | Ga0495602_0836804 | Ga0495602_0836804_230_595 | 121 |
| 123 | 3300048089 | Ga0495614_0159011 | Ga0495614_0159011_276_641 | 121 |
| 124 | 3300048903 | Ga0496100_0000010 | Ga0496100_0000010_10027_10392 | 121 |
| 125 | 3300048904 | Ga0496101_0000025 | Ga0496101_0000025_10027_10392 | 121 |
| 126 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_22643_23008 | 121 |
| 127 | 3300048907 | Ga0496104_0000024 | Ga0496104_0000024_182409_182810 | 121 |
| 128 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_452791_453156 | 121 |
| 129 | 3300048908 | Ga0496105_0000013 | Ga0496105_0000013_47104_47505 | 121 |
| 130 | 3300048909 | Ga0496106_0000012 | Ga0496106_0000012_194785_195150 | 121 |
| 131 | 3300048910 | Ga0496107_0000010 | Ga0496107_0000010_194797_195162 | 121 |
| 132 | 3300048911 | Ga0496108_0000232 | Ga0496108_0000232_37751_38116 | 121 |
| 133 | 3300048911 | Ga0496108_0010260 | Ga0496108_0010260_745_1110 | 121 |
| 134 | 3300048911 | Ga0496108_0934602 | Ga0496108_0934602_129_494 | 121 |
| 135 | 3300048912 | Ga0496109_0000044 | Ga0496109_0000044_121659_122024 | 121 |
| 136 | 3300048912 | Ga0496109_0000462 | Ga0496109_0000462_6627_6992 | 121 |
| 137 | 3300048913 | Ga0496110_0016615 | Ga0496110_0016615_266_679 | 121 |
| 138 | 3300048913 | Ga0496110_0045691 | Ga0496110_0045691_1742_2107 | 121 |
| 139 | 3300048913 | Ga0496110_0198359 | Ga0496110_0198359_1149_1514 | 121 |
| 140 | 3300048914 | Ga0496111_0013646 | Ga0496111_0013646_3722_4087 | 121 |
| 141 | 3300048915 | Ga0496112_0136971 | Ga0496112_0136971_1473_1838 | 121 |
| 142 | 3300048916 | Ga0496113_0716221 | Ga0496113_0716221_197_562 | 121 |
| 143 | 3300048917 | Ga0496114_0000056 | Ga0496114_0000056_11401_11766 | 121 |
| 144 | 3300048918 | Ga0496115_0000031 | Ga0496115_0000031_8768_9226 | 121 |
| 145 | 3300048923 | Ga0496120_0016516 | Ga0496120_0016516_2963_3328 | 121 |
| 146 | 3300048927 | Ga0496124_0197841 | Ga0496124_0197841_698_1063 | 121 |
| 147 | 3300049578 | Ga0501042_0074187 | Ga0501042_0074187_636_1001 | 121 |
| 148 | 3300049581 | Ga0501047_0596819 | Ga0501047_0596819_112_477 | 121 |
| 149 | 3300049586 | Ga0501070_0049076 | Ga0501070_0049076_2339_2704 | 121 |
| 150 | 3300049742 | Ga0501080_0666959 | Ga0501080_0666959_357_722 | 121 |
| 151 | 3300049743 | Ga0501081_0684307 | Ga0501081_0684307_206_670 | 121 |
| 152 | 3300050514 | nmdc:mga08x19_998966_c1 | nmdc:mga08x19_998966_c1_160_525 | 121 |
| 153 | 3300050515 | nmdc:mga0a205_7810_c1 | nmdc:mga0a205_7810_c1_1307_1732 | 121 |
| 154 | 3300053077 | Ga0495601_0000057 | Ga0495601_0000057_11577_11951 | 121 |
| 155 | 3300053077 | Ga0495601_0002292 | Ga0495601_0002292_3682_4047 | 121 |
| 156 | 3300053077 | Ga0495601_0104056 | Ga0495601_0104056_823_1188 | 121 |
| 157 | 3300053078 | Ga0495612_0000031 | Ga0495612_0000031_19185_19550 | 121 |
| 158 | 3300053078 | Ga0495612_0005283 | Ga0495612_0005283_4337_4702 | 121 |
| 159 | 3300053078 | Ga0495612_0012018 | Ga0495612_0012018_105_470 | 121 |
| 160 | 3300053078 | Ga0495612_0132638 | Ga0495612_0132638_328_696 | 121 |
| 161 | 3300053084 | Ga0495595_0000017 | Ga0495595_0000017_124917_125282 | 121 |
| 162 | 3300053085 | Ga0495619_0001050 | Ga0495619_0001050_10003_10368 | 121 |
| 163 | 3300053094 | Ga0500566_0000943 | Ga0500566_0000943_8204_8569 | 121 |
| 164 | 3300053123 | Ga0500614_000630 | Ga0500614_000630_6812_7177 | 121 |
| 165 | 3300060353 | Ga0501082_0696971 | Ga0501082_0696971_264_641 | 121 |
| 166 | 3300061734 | Ga0530510_0186047 | Ga0530510_0186047_252_629 | 121 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1oz9-assembly1.cif.gz_A | crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus | 0.7985 | 3 | 120 |
| 1xm5-assembly1.cif.gz_A | crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 | 0.7826 | 2 | 120 |
| 1oz9-assembly1.cif.gz_A | crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus | 0.7743 | 3 | 120 |
| 1xm5-assembly1.cif.gz_A | crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 | 0.7649 | 2 | 120 |
| 7y7o-assembly1.cif.gz_A | crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus | 0.7599 | 2 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0GDI7_137_270_3.40.390.30 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.8909 | 30 | 120 | 3.40.390.30 |
| af_P9WGX9_1_163_3.40.390.30 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.826 | 1 | 119 | 3.40.390.30 |
| af_Q4DNU0_12_187_3.40.390.30 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.8178 | 11 | 120 | 3.40.390.30 |
| af_P9WGX9_1_163_3.40.390.30 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.8066 | 1 | 119 | 3.40.390.30 |
| 1oz9A00 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.7985 | 3 | 120 | 3.40.390.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0LQ38-F1-model_v4 | Endoribonuclease YbeY (EC 3.1.-.-) | 0.9759 | 3 | 121 |
GO:0004222
GO:0004521 GO:0005737 GO:0006364 GO:0008270 |
| AF-A0A7W0H5P1-F1-model_v4 | Endoribonuclease YbeY (EC 3.1.-.-) | 0.9714 | 3 | 119 |
GO:0004222
GO:0004521 GO:0005737 GO:0006364 GO:0008270 |
| AF-A0A537YV18-F1-model_v4 | Endoribonuclease YbeY (EC 3.1.-.-) | 0.9695 | 1 | 121 |
GO:0004222
GO:0004521 GO:0005737 GO:0006364 GO:0008270 |
| AF-A0A6J7CQH1-F1-model_v4 | Unannotated protein | 0.9637 | 3 | 121 |
GO:0004222
GO:0004519 GO:0006364 GO:0046872 |
| AF-A0A7V9M6D9-F1-model_v4 | rRNA maturation RNase YbeY | 0.9635 | 12 | 121 |
GO:0004222
GO:0004521 GO:0005737 GO:0006364 GO:0008270 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar