F245794

General Info

Members Datasets Scaffolds Average Seq Length
165 121 165 125

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_11640155|Ga0070717_116401552
Length 131
Sequence MIIVDTSVVIDSLSGPKRSASALRSAIERGERLLIPSLVLYEWLRGPRLEEELIAQEALFPSSSAVPFSASEALVSARLYRSVRRPRGRELDLAIAACAVVREAALWTLNEADFRDIPGLRLWPGTTTFES

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
56 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
57 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
58 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
59 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
60 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
61 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
62 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
63 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
64 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
75 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
76 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
94 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 1.82
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 3.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100028999 3300005339 Bacteria 4145
2 Ga0070661_100460947 3300005344 Unclassified 1012
3 Ga0070673_100470329 3300005364 Bacteria 1133
4 Ga0070659_100396577 3300005366 Bacteria 1164
5 Ga0070713_100200698 3300005436 Bacteria 1801
6 Ga0070711_100648086 3300005439 Bacteria 885
7 Ga0070685_10267011 3300005466 Bacteria 1140
8 Ga0070706_100003744 3300005467 Bacteria 14867
9 Ga0070706_100587232 3300005467 Unclassified 1035
10 Ga0070698_100000705 3300005471 Bacteria 35680
11 Ga0070698_101188879 3300005471 Bacteria 712
12 Ga0070698_101283699 3300005471 Unclassified 682
13 Ga0070699_100605511 3300005518 Unclassified 999
14 Ga0070699_101363007 3300005518 Unclassified 650
15 Ga0070684_101065509 3300005535 Unclassified 759
16 Ga0070697_100003550 3300005536 Bacteria 11982
17 Ga0068853_100094905 3300005539 Bacteria 2629
18 Ga0068855_100099503 3300005563 Bacteria 3349
19 Ga0068855_100138758 3300005563 Bacteria 2773
20 Ga0070664_100094521 3300005564 Bacteria 2592
21 Ga0068856_100132618 3300005614 Bacteria 2496
22 Ga0068862_101158713 3300005844 Bacteria 770
23 Ga0070717_10089856 3300006028 Bacteria 2591
24 Ga0070717_11234607 3300006028 Unclassified 680
25 Ga0070717_11640155 3300006028 Unclassified 582
26 Ga0075365_10938088 3300006038 Bacteria 610
27 Ga0070716_100943900 3300006173 Unclassified 678
28 Ga0070712_100146340 3300006175 Unclassified 1809
29 Ga0097621_100223460 3300006237 Bacteria 1642
30 Ga0068871_100142595 3300006358 Bacteria 2038
31 Ga0075433_10057180 3300006852 Unclassified 3409
32 Ga0105240_10138412 3300009093 Bacteria 2913
33 Ga0105240_10380732 3300009093 Bacteria 1594
34 Ga0111539_12575176 3300009094 Bacteria 590
35 Ga0114129_10050794 3300009147 Bacteria 5823
36 Ga0114129_10201887 3300009147 Bacteria 2692
37 Ga0114129_10257213 3300009147 Bacteria 2342
38 Ga0105242_12207558 3300009176 Bacteria 596
39 Ga0105238_10405773 3300009551 Bacteria 1356
40 Ga0105239_12630546 3300010375 Unclassified 587
41 Ga0157370_10127169 3300013104 Unclassified 2378
42 Ga0157370_10154423 3300013104 Unclassified 2136
43 Ga0157370_10515071 3300013104 Bacteria 1098
44 Ga0157369_10002083 3300013105 Bacteria 24186
45 Ga0157374_10046268 3300013296 Bacteria 4029
46 Ga0157372_10024714 3300013307 Bacteria 6530
47 Ga0157372_10109440 3300013307 Bacteria 3164
48 Ga0163163_10220560 3300014325 Bacteria 1945
49 Ga0157376_10161655 3300014969 Unclassified 2031
50 Ga0157376_10835783 3300014969 Bacteria 935
51 Ga0213875_10244102 3300021388 Bacteria 847
52 Ga0207699_10767783 3300025906 Unclassified 708
53 Ga0207684_10003325 3300025910 Bacteria 15794
54 Ga0207695_10402146 3300025913 Bacteria 1254
55 Ga0207695_10708632 3300025913 Bacteria 887
56 Ga0207693_10582141 3300025915 Unclassified 872
57 Ga0207663_10096749 3300025916 Bacteria 1973
58 Ga0207663_10175537 3300025916 Bacteria 1526
59 Ga0207657_10154555 3300025919 Bacteria 1866
60 Ga0207646_10140935 3300025922 Bacteria 2171
61 Ga0207700_10481559 3300025928 Unclassified 1096
62 Ga0207686_10916004 3300025934 Bacteria 708
63 Ga0207665_10741947 3300025939 Unclassified 774
64 Ga0207679_10063608 3300025945 Bacteria 2755
65 Ga0207667_10442816 3300025949 Unclassified 1321
66 Ga0207667_10490470 3300025949 Bacteria 1247
67 Ga0207639_10117092 3300026041 Bacteria 2183
68 Ga0207702_10194523 3300026078 Bacteria 1876
69 Ga0268265_10913232 3300028380 Bacteria 863
70 Ga0265329_10217669 3300031242 Unclassified 631
71 Ga0307413_11320931 3300031824 Bacteria 632
72 Ga0373934_0029055 3300035086 Bacteria 2157
73 Ga0373934_0229500 3300035086 Bacteria 766
74 Ga0373945_0004124 3300035116 Bacteria 4610
75 Ga0373945_0279452 3300035116 Bacteria 711
76 Ga0373953_0417423 3300035117 Bacteria 591
77 Ga0373954_0029244 3300035118 Bacteria 2537
78 Ga0373956_0132276 3300035119 Bacteria 1168
79 Ga0373957_0026599 3300035120 Bacteria 2094
80 Ga0373943_0192172 3300035170 Unclassified 1126
81 Ga0373946_0043480 3300035171 Unclassified 1851
82 Ga0373946_0389310 3300035171 Unclassified 702
83 Ga0373946_0418844 3300035171 Unclassified 678
84 Ga0373946_0743554 3300035171 Bacteria 514
85 Ga0373955_0089753 3300035172 Bacteria 1750
86 Ga0373924_0457456 3300035410 Bacteria 572
87 Ga0373935_0025388 3300035692 Bacteria 3652
88 Ga0373935_0084887 3300035692 Bacteria 2063
89 Ga0373935_0195289 3300035692 Bacteria 1396
90 Ga0373935_0988815 3300035692 Unclassified 625
91 Ga0373927_0002058 3300035695 Bacteria 14844
92 Ga0373927_0167495 3300035695 Bacteria 1440
93 Ga0373927_0321643 3300035695 Bacteria 1019
94 Ga0373933_0068706 3300035724 Bacteria 2152
95 Ga0373947_0000448 3300035725 Bacteria 23434
96 Ga0373947_0401631 3300035725 Bacteria 924
97 Ga0373947_0805126 3300035725 Unclassified 641
98 Ga0373937_0010532 3300036401 Bacteria 8074
99 Ga0373937_0147040 3300036401 Unclassified 2206
100 Ga0373937_0924154 3300036401 Unclassified 821
101 Ga0316584_0268372 3300036712 Bacteria 1243
102 Ga0373925_0000248 3300037068 Bacteria 57273
103 Ga0373925_0069039 3300037068 Bacteria 2669
104 Ga0373925_0127343 3300037068 Unclassified 1982
105 Ga0436364_0049874 3300037853 Unclassified 2118
106 Ga0436364_0373121 3300037853 Unclassified 4694
107 Ga0436364_1180893 3300037853 Bacteria 686
108 Ga0436364_1213008 3300037853 Bacteria 1478
109 Ga0436365_0820685 3300039437 Bacteria 810
110 Ga0436362_1003260 3300039453 Unclassified 1245
111 Ga0451791_0283474 3300041451 Bacteria 776
112 Ga0439435_0026209 3300042436 Bacteria 1550
113 Ga0451577_1189042 3300042876 Bacteria 680
114 Ga0451576_0987789 3300045051 Unclassified 882
115 Ga0495629_0414994 3300046459 Bacteria 914
116 Ga0495653_0275431 3300046463 Bacteria 1107
117 Ga0495580_0007994 3300046472 Bacteria 8451
118 Ga0495582_0235567 3300046473 Bacteria 1048
119 Ga0495639_0077912 3300046475 Bacteria 1540
120 Ga0495664_0073050 3300046477 Bacteria 2051
121 Ga0495608_0252238 3300046511 Bacteria 1100
122 Ga0495608_0424028 3300046511 Bacteria 812
123 Ga0495628_0138844 3300046516 Unclassified 1855
124 Ga0495630_0536570 3300046517 Unclassified 897
125 Ga0495665_0077281 3300046531 Bacteria 1752
126 Ga0495665_0244693 3300046531 Unclassified 924
127 Ga0495586_0019338 3300046535 Bacteria 3624
128 Ga0495586_0111828 3300046535 Bacteria 1520
129 Ga0495645_0266868 3300046543 Bacteria 1131
130 Ga0495667_0341799 3300046559 Bacteria 946
131 Ga0495634_0391965 3300046642 Bacteria 826
132 Ga0495599_0182488 3300046678 Unclassified 1293
133 Ga0495646_0159291 3300046680 Bacteria 1251
134 Ga0495658_0064515 3300046683 Bacteria 2110
135 Ga0495581_0815541 3300047315 Bacteria 535
136 Ga0495604_0213005 3300047317 Bacteria 1334
137 Ga0495674_0258599 3300047319 Unclassified 1431
138 Ga0495674_0336050 3300047319 Unclassified 1228
139 Ga0495674_0377667 3300047319 Bacteria 1147
140 Ga0495680_0445487 3300047322 Bacteria 887
141 Ga0495675_0138432 3300047444 Bacteria 1510
142 Ga0495684_0222767 3300047471 Bacteria 1382
143 Ga0496104_0527955 3300048907 Unclassified 1091
144 Ga0496115_0018261 3300048918 Bacteria 5381
145 Ga0501034_0187809 3300049571 Unclassified 2029
146 Ga0501037_0248303 3300049573 Bacteria 1246
147 Ga0501039_1524851 3300049575 Unclassified 514
148 Ga0501040_0111274 3300049576 Bacteria 1915
149 Ga0501043_0158241 3300049579 Unclassified 1771
150 Ga0501046_0258165 3300049580 Unclassified 1281
151 Ga0501047_0120717 3300049581 Unclassified 2503
152 Ga0501070_0111846 3300049586 Bacteria 2257
153 Ga0501072_0058189 3300049588 Bacteria 3047
154 Ga0501073_0465172 3300049589 Unclassified 874
155 Ga0501074_0214981 3300049590 Bacteria 1369
156 Ga0501075_1106010 3300049591 Bacteria 602
157 Ga0501081_1559879 3300049743 Unclassified 502
158 Ga0501035_0015890 3300049822 Bacteria 6946
159 Ga0501035_0466558 3300049822 Unclassified 1043
160 Ga0501044_1672709 3300049823 Unclassified 501
161 nmdc:mga0yw44_383279_c1 3300050492 Bacteria 949
162 nmdc:mga05p37_118946_c1 3300050507 Bacteria 3246
163 nmdc:mga05p37_151459_c1 3300050507 Unclassified 2836
164 nmdc:mga05p37_612534_c1 3300050507 Bacteria 1227
165 Ga0530510_0858034 3300061734 Unclassified 693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005518 Ga0070699_100605511 Ga0070699_1006055112 107
2 3300035171 Ga0373946_0418844 Ga0373946_0418844_16_357 110
3 3300049743 Ga0501081_1559879 Ga0501081_1559879_73_453 110
4 3300041451 Ga0451791_0283474 Ga0451791_0283474_135_500 112
5 3300049575 Ga0501039_1524851 Ga0501039_1524851_143_499 117
6 3300049591 Ga0501075_1106010 Ga0501075_1106010_88_450 120
7 3300049588 Ga0501072_0058189 Ga0501072_0058189_973_1350 122
8 3300005364 Ga0070673_100470329 Ga0070673_1004703292 123
9 3300005563 Ga0068855_100138758 Ga0068855_1001387583 123
10 3300006852 Ga0075433_10057180 Ga0075433_100571804 123
11 3300009093 Ga0105240_10138412 Ga0105240_101384122 123
12 3300025913 Ga0207695_10708632 Ga0207695_107086323 123
13 3300025949 Ga0207667_10490470 Ga0207667_104904702 123
14 3300036401 Ga0373937_0924154 Ga0373937_0924154_285_659 123
15 3300046517 Ga0495630_0536570 Ga0495630_0536570_402_776 123
16 3300005439 Ga0070711_100648086 Ga0070711_1006480862 124
17 3300005471 Ga0070698_101188879 Ga0070698_1011888792 124
18 3300005614 Ga0068856_100132618 Ga0068856_1001326183 124
19 3300005844 Ga0068862_101158713 Ga0068862_1011587132 124
20 3300009147 Ga0114129_10201887 Ga0114129_102018873 124
21 3300013104 Ga0157370_10515071 Ga0157370_105150712 124
22 3300025916 Ga0207663_10175537 Ga0207663_101755372 124
23 3300026078 Ga0207702_10194523 Ga0207702_101945233 124
24 3300028380 Ga0268265_10913232 Ga0268265_109132322 124
25 3300035086 Ga0373934_0229500 Ga0373934_0229500_256_630 124
26 3300035117 Ga0373953_0417423 Ga0373953_0417423_60_434 124
27 3300035120 Ga0373957_0026599 Ga0373957_0026599_1264_1638 124
28 3300035171 Ga0373946_0389310 Ga0373946_0389310_154_528 124
29 3300035171 Ga0373946_0743554 Ga0373946_0743554_97_471 124
30 3300035172 Ga0373955_0089753 Ga0373955_0089753_1130_1504 124
31 3300035410 Ga0373924_0457456 Ga0373924_0457456_28_402 124
32 3300035692 Ga0373935_0195289 Ga0373935_0195289_273_647 124
33 3300035695 Ga0373927_0167495 Ga0373927_0167495_824_1198 124
34 3300035724 Ga0373933_0068706 Ga0373933_0068706_1620_1994 124
35 3300036401 Ga0373937_0010532 Ga0373937_0010532_6562_6936 124
36 3300037068 Ga0373925_0069039 Ga0373925_0069039_1632_2006 124
37 3300046459 Ga0495629_0414994 Ga0495629_0414994_30_404 124
38 3300046463 Ga0495653_0275431 Ga0495653_0275431_502_876 124
39 3300046473 Ga0495582_0235567 Ga0495582_0235567_92_466 124
40 3300046475 Ga0495639_0077912 Ga0495639_0077912_913_1287 124
41 3300046511 Ga0495608_0424028 Ga0495608_0424028_304_678 124
42 3300046531 Ga0495665_0077281 Ga0495665_0077281_651_1025 124
43 3300046535 Ga0495586_0019338 Ga0495586_0019338_123_497 124
44 3300046535 Ga0495586_0111828 Ga0495586_0111828_533_907 124
45 3300046642 Ga0495634_0391965 Ga0495634_0391965_164_538 124
46 3300046683 Ga0495658_0064515 Ga0495658_0064515_528_902 124
47 3300047315 Ga0495581_0815541 Ga0495581_0815541_121_495 124
48 3300047444 Ga0495675_0138432 Ga0495675_0138432_1098_1472 124
49 3300047471 Ga0495684_0222767 Ga0495684_0222767_141_515 124
50 3300050507 nmdc:mga05p37_118946_c1 nmdc:mga05p37_118946_c1_1779_2153 124
51 3300005339 Ga0070660_100028999 Ga0070660_1000289993 125
52 3300005344 Ga0070661_100460947 Ga0070661_1004609472 125
53 3300005366 Ga0070659_100396577 Ga0070659_1003965772 125
54 3300005436 Ga0070713_100200698 Ga0070713_1002006982 125
55 3300005466 Ga0070685_10267011 Ga0070685_102670111 125
56 3300005467 Ga0070706_100003744 Ga0070706_10000374413 125
57 3300005467 Ga0070706_100587232 Ga0070706_1005872322 125
58 3300005471 Ga0070698_100000705 Ga0070698_10000070538 125
59 3300005471 Ga0070698_101283699 Ga0070698_1012836991 125
60 3300005518 Ga0070699_101363007 Ga0070699_1013630071 125
61 3300005535 Ga0070684_101065509 Ga0070684_1010655092 125
62 3300005536 Ga0070697_100003550 Ga0070697_1000035506 125
63 3300005539 Ga0068853_100094905 Ga0068853_1000949053 125
64 3300005563 Ga0068855_100099503 Ga0068855_1000995032 125
65 3300005564 Ga0070664_100094521 Ga0070664_1000945212 125
66 3300006028 Ga0070717_10089856 Ga0070717_100898563 125
67 3300006028 Ga0070717_11234607 Ga0070717_112346072 125
68 3300006028 Ga0070717_11640155 Ga0070717_116401552 125
69 3300006038 Ga0075365_10938088 Ga0075365_109380882 125
70 3300006173 Ga0070716_100943900 Ga0070716_1009439002 125
71 3300006175 Ga0070712_100146340 Ga0070712_1001463402 125
72 3300006237 Ga0097621_100223460 Ga0097621_1002234603 125
73 3300006358 Ga0068871_100142595 Ga0068871_1001425954 125
74 3300009093 Ga0105240_10380732 Ga0105240_103807323 125
75 3300009094 Ga0111539_12575176 Ga0111539_125751761 125
76 3300009147 Ga0114129_10050794 Ga0114129_100507943 125
77 3300009147 Ga0114129_10257213 Ga0114129_102572133 125
78 3300009176 Ga0105242_12207558 Ga0105242_122075581 125
79 3300009551 Ga0105238_10405773 Ga0105238_104057733 125
80 3300010375 Ga0105239_12630546 Ga0105239_126305461 125
81 3300013104 Ga0157370_10127169 Ga0157370_101271692 125
82 3300013104 Ga0157370_10154423 Ga0157370_101544231 125
83 3300013105 Ga0157369_10002083 Ga0157369_1000208313 125
84 3300013296 Ga0157374_10046268 Ga0157374_100462683 125
85 3300013307 Ga0157372_10024714 Ga0157372_100247147 125
86 3300013307 Ga0157372_10109440 Ga0157372_101094403 125
87 3300014325 Ga0163163_10220560 Ga0163163_102205602 125
88 3300014969 Ga0157376_10161655 Ga0157376_101616552 125
89 3300014969 Ga0157376_10835783 Ga0157376_108357832 125
90 3300021388 Ga0213875_10244102 Ga0213875_102441022 125
91 3300025906 Ga0207699_10767783 Ga0207699_107677832 125
92 3300025910 Ga0207684_10003325 Ga0207684_1000332513 125
93 3300025913 Ga0207695_10402146 Ga0207695_104021461 125
94 3300025915 Ga0207693_10582141 Ga0207693_105821412 125
95 3300025916 Ga0207663_10096749 Ga0207663_100967492 125
96 3300025919 Ga0207657_10154555 Ga0207657_101545553 125
97 3300025922 Ga0207646_10140935 Ga0207646_101409353 125
98 3300025928 Ga0207700_10481559 Ga0207700_104815593 125
99 3300025934 Ga0207686_10916004 Ga0207686_109160042 125
100 3300025939 Ga0207665_10741947 Ga0207665_107419472 125
101 3300025945 Ga0207679_10063608 Ga0207679_100636083 125
102 3300025949 Ga0207667_10442816 Ga0207667_104428162 125
103 3300026041 Ga0207639_10117092 Ga0207639_101170923 125
104 3300031242 Ga0265329_10217669 Ga0265329_102176691 125
105 3300031824 Ga0307413_11320931 Ga0307413_113209312 125
106 3300035086 Ga0373934_0029055 Ga0373934_0029055_1641_2033 125
107 3300035116 Ga0373945_0004124 Ga0373945_0004124_1599_1976 125
108 3300035116 Ga0373945_0279452 Ga0373945_0279452_190_582 125
109 3300035118 Ga0373954_0029244 Ga0373954_0029244_1600_1992 125
110 3300035119 Ga0373956_0132276 Ga0373956_0132276_526_918 125
111 3300035170 Ga0373943_0192172 Ga0373943_0192172_629_1006 125
112 3300035171 Ga0373946_0043480 Ga0373946_0043480_194_571 125
113 3300035692 Ga0373935_0025388 Ga0373935_0025388_1857_2234 125
114 3300035692 Ga0373935_0084887 Ga0373935_0084887_1547_1939 125
115 3300035692 Ga0373935_0988815 Ga0373935_0988815_20_400 125
116 3300035695 Ga0373927_0002058 Ga0373927_0002058_8477_8854 125
117 3300035695 Ga0373927_0321643 Ga0373927_0321643_26_406 125
118 3300035725 Ga0373947_0000448 Ga0373947_0000448_10968_11345 125
119 3300035725 Ga0373947_0401631 Ga0373947_0401631_272_664 125
120 3300035725 Ga0373947_0805126 Ga0373947_0805126_218_598 125
121 3300036401 Ga0373937_0147040 Ga0373937_0147040_1171_1563 125
122 3300036712 Ga0316584_0268372 Ga0316584_0268372_456_833 125
123 3300037068 Ga0373925_0000248 Ga0373925_0000248_32696_33073 125
124 3300037068 Ga0373925_0127343 Ga0373925_0127343_1541_1933 125
125 3300037853 Ga0436364_0049874 Ga0436364_0049874_1018_1395 125
126 3300037853 Ga0436364_0373121 Ga0436364_0373121_2621_2998 125
127 3300037853 Ga0436364_1180893 Ga0436364_1180893_141_527 125
128 3300037853 Ga0436364_1213008 Ga0436364_1213008_702_1079 125
129 3300039437 Ga0436365_0820685 Ga0436365_0820685_390_767 125
130 3300039453 Ga0436362_1003260 Ga0436362_1003260_15_392 125
131 3300042436 Ga0439435_0026209 Ga0439435_0026209_352_732 125
132 3300042876 Ga0451577_1189042 Ga0451577_1189042_210_602 125
133 3300045051 Ga0451576_0987789 Ga0451576_0987789_446_823 125
134 3300046472 Ga0495580_0007994 Ga0495580_0007994_580_972 125
135 3300046477 Ga0495664_0073050 Ga0495664_0073050_1558_1950 125
136 3300046511 Ga0495608_0252238 Ga0495608_0252238_482_874 125
137 3300046516 Ga0495628_0138844 Ga0495628_0138844_721_1107 125
138 3300046531 Ga0495665_0244693 Ga0495665_0244693_493_885 125
139 3300046543 Ga0495645_0266868 Ga0495645_0266868_221_613 125
140 3300046559 Ga0495667_0341799 Ga0495667_0341799_90_482 125
141 3300046678 Ga0495599_0182488 Ga0495599_0182488_326_712 125
142 3300046680 Ga0495646_0159291 Ga0495646_0159291_452_844 125
143 3300047317 Ga0495604_0213005 Ga0495604_0213005_907_1293 125
144 3300047319 Ga0495674_0258599 Ga0495674_0258599_1011_1391 125
145 3300047319 Ga0495674_0336050 Ga0495674_0336050_296_676 125
146 3300047319 Ga0495674_0377667 Ga0495674_0377667_540_932 125
147 3300047322 Ga0495680_0445487 Ga0495680_0445487_369_761 125
148 3300048907 Ga0496104_0527955 Ga0496104_0527955_399_776 125
149 3300048918 Ga0496115_0018261 Ga0496115_0018261_3949_4326 125
150 3300049571 Ga0501034_0187809 Ga0501034_0187809_1206_1586 125
151 3300049573 Ga0501037_0248303 Ga0501037_0248303_162_542 125
152 3300049576 Ga0501040_0111274 Ga0501040_0111274_1378_1758 125
153 3300049579 Ga0501043_0158241 Ga0501043_0158241_168_548 125
154 3300049580 Ga0501046_0258165 Ga0501046_0258165_372_752 125
155 3300049581 Ga0501047_0120717 Ga0501047_0120717_735_1115 125
156 3300049586 Ga0501070_0111846 Ga0501070_0111846_1588_1968 125
157 3300049589 Ga0501073_0465172 Ga0501073_0465172_359_739 125
158 3300049590 Ga0501074_0214981 Ga0501074_0214981_158_538 125
159 3300049822 Ga0501035_0015890 Ga0501035_0015890_454_834 125
160 3300049822 Ga0501035_0466558 Ga0501035_0466558_490_867 125
161 3300049823 Ga0501044_1672709 Ga0501044_1672709_94_474 125
162 3300050492 nmdc:mga0yw44_383279_c1 nmdc:mga0yw44_383279_c1_37_414 125
163 3300050507 nmdc:mga05p37_151459_c1 nmdc:mga05p37_151459_c1_2130_2510 125
164 3300050507 nmdc:mga05p37_612534_c1 nmdc:mga05p37_612534_c1_509_892 125
165 3300061734 Ga0530510_0858034 Ga0530510_0858034_60_440 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

2

120

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k8j-assembly1.cif.gz_B structure of caulobacter crescentus vapbc1 (apo form) 0.8528 1 125
5k8j-assembly1.cif.gz_B structure of caulobacter crescentus vapbc1 (apo form) 0.8465 1 125
6ifm-assembly1.cif.gz_C crystal structure of dna bound vapbc from salmonella typhimurium 0.8255 2 124
5h4g-assembly1.cif.gz_A structure of pin-domain protein (vapc4 toxin) from pyrococcus horikoshii determined at 1.77 a resolution 0.8108 2 124
6ifm-assembly1.cif.gz_C crystal structure of dna bound vapbc from salmonella typhimurium 0.8075 2 124
ID Description Score Start End Superfamily
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8538 1 121 3.40.50.1010
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8347 1 121 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7971 2 125 3.40.50.1010
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7968 1 122 3.40.50.1010
5k8jC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7958 1 125 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A2V8V4N7-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9956 2 124 GO:0000287
GO:0004540
GO:0090729
AF-A0A1Q7S583-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9901 1 125 GO:0000287
GO:0004540
GO:0090729
AF-A0A2V8C6F8-F1-model_v4 PIN domain-containing protein 0.9873 48 123
AF-A0A7X2PQU2-F1-model_v4 PIN domain-containing protein 0.986 2 125 GO:0004518
GO:0046872
AF-A0A640Y0W4-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9851 2 123 GO:0000287
GO:0004540
GO:0090729

Feature Viewer

pLDDT pTM Quality
96.62 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map