F245741

General Info

Members Datasets Scaffolds Average Seq Length
165 119 330 418

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100003869|Ga0068858_1000038692
Length 445
Sequence VHTSTLDLLRCPYCGGRLDLVTSLFHQIDGDEIHDGILGCHCCIFPVVAGIPVLHLQSAATSARDHVQAGHPELARRTMFGLEDERQAEAFDATARSTTATYRDLVEALGPNFEGGYFLYRFSDPTYVVADAVVRAVAGRVLATGGRAVDICGGSGHLTRSLVGLGSAPPVLADLYFAKVWLGRRFTAPGCEAICCDGNAPMPFARGAFRLAMCVDAFMYIWTKRQFVADLVRLIDNEDHDHRAHRDHGVRHPGDDAGARREGRLDDLGGEPGAVLIGHTHNELEWCPSHGQPLSPAGYRDLFETIDPRIFGESGLFADVVKGGPLDLSRRDAEDVVNHEVALTIIASRRADVFQPHPIEAPRANGELRVNPLYAAEQEGDQVRFRLRFPSDDYEQEYGACREYLPETVVLDRRTLAAISEGRVPADLEDLVRRRVIVDLPRRYY

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
73 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
74 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
81 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.67
Rhizosphere 92.12
Stem 0
Stem Tuber 0
Unclassified 23.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100003869 3300005842 Bacteria 14793
2 Ga0070670_100028070 3300005331 Bacteria 4843
3 Ga0068869_100187177 3300005334 Bacteria 1626
4 Ga0070660_100002545 3300005339 Bacteria 12492
5 Ga0070660_100030378 3300005339 Unclassified 4054
6 Ga0070661_100227627 3300005344 Unclassified 1432
7 Ga0070671_100043280 3300005355 Unclassified 3742
8 Ga0070674_100036936 3300005356 Bacteria 3283
9 Ga0070674_100067244 3300005356 Bacteria 2520
10 Ga0070688_100002387 3300005365 Bacteria 9485
11 Ga0070659_100037566 3300005366 Bacteria 3776
12 Ga0070709_10017713 3300005434 Unclassified 4091
13 Ga0070709_10109558 3300005434 Bacteria 1854
14 Ga0070713_100010070 3300005436 Bacteria 6817
15 Ga0070711_100239975 3300005439 Bacteria 1417
16 Ga0070708_100056950 3300005445 Bacteria 3478
17 Ga0070678_100185744 3300005456 Bacteria 1706
18 Ga0070678_100273610 3300005456 Bacteria 1425
19 Ga0070681_10012443 3300005458 Bacteria 8441
20 Ga0070681_10039139 3300005458 Bacteria 4753
21 Ga0070681_10200442 3300005458 Unclassified 1914
22 Ga0070707_100143288 3300005468 Bacteria 2326
23 Ga0070698_100035271 3300005471 Bacteria 5173
24 Ga0070698_100059085 3300005471 Bacteria 3874
25 Ga0070699_100052027 3300005518 Bacteria 3546
26 Ga0070679_100096148 3300005530 Bacteria 2950
27 Ga0070679_100373369 3300005530 Bacteria 1373
28 Ga0070695_100001307 3300005545 Bacteria 13765
29 Ga0070665_100233950 3300005548 Bacteria 1838
30 Ga0070704_100012580 3300005549 Bacteria 5230
31 Ga0070704_100101238 3300005549 Bacteria 2171
32 Ga0068855_100045714 3300005563 Bacteria 5177
33 Ga0068855_100166199 3300005563 Bacteria 2501
34 Ga0068857_100101414 3300005577 Unclassified 2583
35 Ga0068864_100006668 3300005618 Bacteria 9453
36 Ga0068861_100013505 3300005719 Bacteria 5715
37 Ga0068860_100113739 3300005843 Bacteria 2588
38 Ga0081539_10013351 3300005985 Bacteria 6194
39 Ga0097621_100000434 3300006237 Bacteria 29118
40 Ga0097621_100009378 3300006237 Bacteria 7102
41 Ga0097621_100012421 3300006237 Bacteria 6314
42 Ga0097621_100040273 3300006237 Bacteria 3756
43 Ga0097621_100264713 3300006237 Unclassified 1509
44 Ga0068871_100000723 3300006358 Bacteria 22375
45 Ga0068871_100018396 3300006358 Bacteria 5309
46 Ga0068871_100063926 3300006358 Bacteria 3011
47 Ga0075431_100054187 3300006847 Unclassified 4136
48 Ga0075434_100025374 3300006871 Bacteria 5798
49 Ga0075429_100170033 3300006880 Bacteria 1909
50 Ga0068865_100124552 3300006881 Bacteria 1921
51 Ga0075436_100035719 3300006914 Bacteria 3427
52 Ga0075436_100089974 3300006914 Bacteria 2133
53 Ga0075435_100001670 3300007076 Bacteria 14403
54 Ga0075435_100011539 3300007076 Bacteria 6507
55 Ga0075435_100114543 3300007076 Bacteria 2244
56 Ga0075435_100127511 3300007076 Bacteria 2127
57 Ga0099794_10036124 3300007265 Unclassified 2334
58 Ga0105240_10023741 3300009093 Bacteria 8101
59 Ga0111539_10014363 3300009094 Bacteria 9884
60 Ga0105245_10042423 3300009098 Unclassified 4060
61 Ga0105247_10112661 3300009101 Bacteria 1753
62 Ga0114129_10002855 3300009147 Bacteria 24166
63 Ga0114129_10003412 3300009147 Bacteria 22328
64 Ga0114129_10021193 3300009147 Bacteria 9231
65 Ga0114129_10027891 3300009147 Bacteria 7995
66 Ga0114129_10045457 3300009147 Bacteria 6172
67 Ga0114129_10291454 3300009147 Unclassified 2178
68 Ga0105242_10108132 3300009176 Bacteria 2366
69 Ga0105242_10241169 3300009176 Bacteria 1625
70 Ga0105248_10014969 3300009177 Bacteria 8539
71 Ga0105248_10237013 3300009177 Unclassified 2054
72 Ga0105248_10345226 3300009177 Bacteria 1676
73 Ga0157374_10089837 3300013296 Bacteria 2928
74 Ga0157375_10153506 3300013308 Bacteria 2440
75 Ga0157375_10361939 3300013308 Bacteria 1617
76 Ga0163163_10036773 3300014325 Bacteria 4758
77 Ga0157379_10069472 3300014968 Unclassified 3150
78 Ga0157376_10007090 3300014969 Bacteria 7957
79 Ga0157376_10319634 3300014969 Bacteria 1475
80 Ga0207680_10160504 3300025903 Bacteria 1507
81 Ga0207699_10147665 3300025906 Unclassified 1552
82 Ga0207663_10188809 3300025916 Bacteria 1478
83 Ga0207660_10099860 3300025917 Unclassified 2166
84 Ga0207657_10055754 3300025919 Unclassified 3412
85 Ga0207646_10113479 3300025922 Bacteria 2433
86 Ga0207700_10061679 3300025928 Unclassified 2845
87 Ga0207644_10246593 3300025931 Unclassified 1424
88 Ga0207686_10122409 3300025934 Bacteria 1772
89 Ga0207711_10037295 3300025941 Bacteria 4127
90 Ga0207689_10157397 3300025942 Unclassified 1873
91 Ga0207651_10009246 3300025960 Bacteria 5381
92 Ga0207677_10166985 3300026023 Bacteria 1716
93 Ga0207703_10007832 3300026035 Bacteria 8450
94 Ga0207676_10023696 3300026095 Bacteria 4534
95 Ga0207675_100043269 3300026118 Bacteria 4206
96 Ga0207683_10056198 3300026121 Bacteria 3452
97 Ga0207428_10036863 3300027907 Bacteria 3983
98 Ga0268266_10032426 3300028379 Bacteria 4439
99 Ga0268266_10053190 3300028379 Unclassified 3478
100 Ga0265314_10018627 3300031711 Bacteria 5407
101 Ga0265314_10022808 3300031711 Bacteria 4790
102 Ga0373923_0019628 3300035111 Bacteria 2619
103 Ga0373936_0024093 3300035113 Unclassified 2375
104 Ga0373945_0053435 3300035116 Unclassified 1491
105 Ga0373956_0085346 3300035119 Bacteria 1452
106 Ga0373946_0008794 3300035171 Bacteria 3707
107 Ga0373935_0018489 3300035692 Unclassified 4240
108 Ga0373947_0102455 3300035725 Unclassified 1800
109 Ga0373937_0012396 3300036401 Bacteria 7497
110 Ga0373925_0030120 3300037068 Unclassified 3982
111 Ga0436365_0638445 3300039437 Bacteria 2149
112 Ga0436365_0648650 3300039437 Unclassified 1489
113 Ga0439462_0011777 3300042015 Bacteria 2230
114 Ga0439434_0014535 3300042435 Bacteria 2342
115 Ga0466963_0080063 3300044694 Bacteria 2211
116 Ga0451576_0126142 3300045051 Bacteria 2667
117 Ga0495608_0005022 3300046511 Bacteria 9466
118 Ga0495628_0049755 3300046516 Unclassified 3317
119 Ga0495587_0073134 3300046536 Bacteria 1992
120 Ga0495667_0015946 3300046559 Bacteria 5079
121 Ga0495658_0018696 3300046683 Bacteria 3607
122 Ga0495658_0046289 3300046683 Unclassified 2445
123 Ga0495658_0102009 3300046683 Bacteria 1714
124 Ga0495669_0004879 3300046684 Bacteria 5566
125 Ga0495669_0043515 3300046684 Unclassified 1999
126 Ga0495613_0002297 3300046689 Bacteria 14479
127 Ga0495600_0065915 3300046809 Bacteria 2368
128 Ga0495604_0031903 3300047317 Bacteria 4177
129 Ga0495604_0166313 3300047317 Unclassified 1555
130 Ga0495674_0008046 3300047319 Bacteria 10065
131 Ga0495684_0000747 3300047471 Bacteria 26203
132 Ga0495684_0211009 3300047471 Bacteria 1428
133 Ga0496100_0015930 3300048903 Unclassified 4402
134 Ga0496101_0000503 3300048904 Bacteria 24571
135 Ga0496102_0135232 3300048905 Bacteria 2310
136 Ga0496104_0007612 3300048907 Bacteria 9588
137 Ga0496104_0078112 3300048907 Bacteria 3154
138 Ga0496105_0151539 3300048908 Unclassified 1905
139 Ga0496106_0003423 3300048909 Bacteria 11820
140 Ga0496107_0205380 3300048910 Unclassified 1464
141 Ga0496108_0037493 3300048911 Bacteria 4038
142 Ga0496109_0246241 3300048912 Unclassified 1683
143 Ga0496114_0000636 3300048917 Bacteria 25883
144 Ga0501034_0139801 3300049571 Unclassified 2402
145 Ga0501047_0003644 3300049581 Bacteria 14513
146 Ga0501074_0198292 3300049590 Bacteria 1431
147 Ga0501077_0029371 3300049593 Bacteria 3495
148 Ga0501083_0160688 3300049744 Bacteria 1470
149 Ga0501044_0005292 3300049823 Bacteria 14348
150 nmdc:mga05p37_16537_c1 3300050507 Bacteria 8888
151 nmdc:mga05p37_184713_c1 3300050507 Bacteria 2535
152 nmdc:mga05p37_74289_c1 3300050507 Bacteria 4184
153 nmdc:mga06r32_173664_c1 3300050510 Unclassified 2139
154 nmdc:mga08y16_10480_c1 3300050511 Bacteria 9723
155 nmdc:mga08y16_121697_c1 3300050511 Unclassified 2716
156 nmdc:mga0n895_10643_c1 3300050512 Bacteria 8142
157 nmdc:mga0n895_301560_c1 3300050512 Unclassified 1624
158 nmdc:mga0rr50_17632_c1 3300050513 Bacteria 4772
159 nmdc:mga0rr50_3831_c1 3300050513 Bacteria 8732
160 nmdc:mga08x19_188393_c1 3300050514 Unclassified 1411
161 nmdc:mga08x19_2617_c1 3300050514 Bacteria 10916
162 nmdc:mga0a205_34203_c1 3300050515 Bacteria 4876
163 Ga0495601_0000931 3300053077 Bacteria 15878
164 Ga0495601_0025128 3300053077 Bacteria 3671
165 Ga0495619_0001802 3300053085 Bacteria 14250
166 Ga0068858_100003869
167 Ga0070670_100028070
168 Ga0068869_100187177
169 Ga0070660_100002545
170 Ga0070660_100030378
171 Ga0070661_100227627
172 Ga0070671_100043280
173 Ga0070674_100036936
174 Ga0070674_100067244
175 Ga0070688_100002387
176 Ga0070659_100037566
177 Ga0070709_10017713
178 Ga0070709_10109558
179 Ga0070713_100010070
180 Ga0070711_100239975
181 Ga0070708_100056950
182 Ga0070678_100185744
183 Ga0070678_100273610
184 Ga0070681_10012443
185 Ga0070681_10039139
186 Ga0070681_10200442
187 Ga0070707_100143288
188 Ga0070698_100035271
189 Ga0070698_100059085
190 Ga0070699_100052027
191 Ga0070679_100096148
192 Ga0070679_100373369
193 Ga0070695_100001307
194 Ga0070665_100233950
195 Ga0070704_100012580
196 Ga0070704_100101238
197 Ga0068855_100045714
198 Ga0068855_100166199
199 Ga0068857_100101414
200 Ga0068864_100006668
201 Ga0068861_100013505
202 Ga0068860_100113739
203 Ga0081539_10013351
204 Ga0097621_100000434
205 Ga0097621_100009378
206 Ga0097621_100012421
207 Ga0097621_100040273
208 Ga0097621_100264713
209 Ga0068871_100000723
210 Ga0068871_100018396
211 Ga0068871_100063926
212 Ga0075431_100054187
213 Ga0075434_100025374
214 Ga0075429_100170033
215 Ga0068865_100124552
216 Ga0075436_100035719
217 Ga0075436_100089974
218 Ga0075435_100001670
219 Ga0075435_100011539
220 Ga0075435_100114543
221 Ga0075435_100127511
222 Ga0099794_10036124
223 Ga0105240_10023741
224 Ga0111539_10014363
225 Ga0105245_10042423
226 Ga0105247_10112661
227 Ga0114129_10002855
228 Ga0114129_10003412
229 Ga0114129_10021193
230 Ga0114129_10027891
231 Ga0114129_10045457
232 Ga0114129_10291454
233 Ga0105242_10108132
234 Ga0105242_10241169
235 Ga0105248_10014969
236 Ga0105248_10237013
237 Ga0105248_10345226
238 Ga0157374_10089837
239 Ga0157375_10153506
240 Ga0157375_10361939
241 Ga0163163_10036773
242 Ga0157379_10069472
243 Ga0157376_10007090
244 Ga0157376_10319634
245 Ga0207680_10160504
246 Ga0207699_10147665
247 Ga0207663_10188809
248 Ga0207660_10099860
249 Ga0207657_10055754
250 Ga0207646_10113479
251 Ga0207700_10061679
252 Ga0207644_10246593
253 Ga0207686_10122409
254 Ga0207711_10037295
255 Ga0207689_10157397
256 Ga0207651_10009246
257 Ga0207677_10166985
258 Ga0207703_10007832
259 Ga0207676_10023696
260 Ga0207675_100043269
261 Ga0207683_10056198
262 Ga0207428_10036863
263 Ga0268266_10032426
264 Ga0268266_10053190
265 Ga0265314_10018627
266 Ga0265314_10022808
267 Ga0373923_0019628
268 Ga0373936_0024093
269 Ga0373945_0053435
270 Ga0373956_0085346
271 Ga0373946_0008794
272 Ga0373935_0018489
273 Ga0373947_0102455
274 Ga0373937_0012396
275 Ga0373925_0030120
276 Ga0436365_0638445
277 Ga0436365_0648650
278 Ga0439462_0011777
279 Ga0439434_0014535
280 Ga0466963_0080063
281 Ga0451576_0126142
282 Ga0495608_0005022
283 Ga0495628_0049755
284 Ga0495587_0073134
285 Ga0495667_0015946
286 Ga0495658_0018696
287 Ga0495658_0046289
288 Ga0495658_0102009
289 Ga0495669_0004879
290 Ga0495669_0043515
291 Ga0495613_0002297
292 Ga0495600_0065915
293 Ga0495604_0031903
294 Ga0495604_0166313
295 Ga0495674_0008046
296 Ga0495684_0000747
297 Ga0495684_0211009
298 Ga0496100_0015930
299 Ga0496101_0000503
300 Ga0496102_0135232
301 Ga0496104_0007612
302 Ga0496104_0078112
303 Ga0496105_0151539
304 Ga0496106_0003423
305 Ga0496107_0205380
306 Ga0496108_0037493
307 Ga0496109_0246241
308 Ga0496114_0000636
309 Ga0501034_0139801
310 Ga0501047_0003644
311 Ga0501074_0198292
312 Ga0501077_0029371
313 Ga0501083_0160688
314 Ga0501044_0005292
315 nmdc:mga05p37_16537_c1
316 nmdc:mga05p37_184713_c1
317 nmdc:mga05p37_74289_c1
318 nmdc:mga06r32_173664_c1
319 nmdc:mga08y16_10480_c1
320 nmdc:mga08y16_121697_c1
321 nmdc:mga0n895_10643_c1
322 nmdc:mga0n895_301560_c1
323 nmdc:mga0rr50_17632_c1
324 nmdc:mga0rr50_3831_c1
325 nmdc:mga08x19_188393_c1
326 nmdc:mga08x19_2617_c1
327 nmdc:mga0a205_34203_c1
328 Ga0495601_0000931
329 Ga0495601_0025128
330 Ga0495619_0001802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bxo-assembly1.cif.gz_B crystal structure of streptomyces venezuelae desvi 0.7746 126 245
3cgg-assembly2.cif.gz_B crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution 0.7653 136 315
5bsz-assembly1.cif.gz_A x-ray structure of the sugar n-methyltransferase keds8 from streptoalloteichus sp atcc 53650 0.7569 129 245
3ujc-assembly1.cif.gz_A phosphoethanolamine methyltransferase mutant (h132a) from plasmodium falciparum in complex with phosphocholine 0.7552 138 290
3ujd-assembly1.cif.gz_A phosphoethanolamine methyltransferase mutant (y19f) from plasmodium falciparum in complex with phosphocholine 0.7422 138 290
ID Description Score Start End Superfamily
af_Q7K1S1_72_273_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8369 147 246 3.40.50.150
af_A0A0N7KI91_1_189_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8307 137 239 3.40.50.150
af_P91387_125_346_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8266 141 250 3.40.50.150
af_Q50584_122_315_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8164 127 239 3.40.50.150
af_Q4E0U0_156_318_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8069 147 246 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V8FXN1-F1-model_v4 Methyltransferase domain-containing protein 0.9828 1 221
AF-A0A2V8FLB6-F1-model_v4 Methyltransferase domain-containing protein 0.9749 1 414
AF-A0A2V8E498-F1-model_v4 Class I SAM-dependent methyltransferase 0.9742 142 414
AF-A0A2V8FLB6-F1-model_v4 Methyltransferase domain-containing protein 0.9726 1 414
AF-A0A2V8FXN1-F1-model_v4 Methyltransferase domain-containing protein 0.9698 1 221

Map