F244955

General Info

Members Datasets Scaffolds Average Seq Length
164 100 328 321

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0000532|Ga0501082_0000532_10155_11231
Length 358
Sequence MGGPDLVFAVVAFLIFSVALFAAGYYVWSVPQQAAEQVLGARLRELRAHARSRSKAAPDLLRREHRGTFAFLGDFVSWVGVLRRLQELIEQANLKYRAADVFGLSLLLGVGSFLGFAVLGGGIHYIHLRAGETATIDGVQYVGERMTFVASNLIFLHILIAAALGFAPVTYILQVRKKRLAKFEQQLPDAIDLFTRTMRAGHNIHSGLETIANETADPVRMEFKKLMEELALGSQVEPALHGVGKRVPLIDLKFFITALILQRQTGANMVAVLENLSTLVRERLNMAAKLKAHTAQQRFSAGLLCALPLVVGIGFWILKPEYVRLLWTDPVGSKFFTYAIVSEIIGILVIRKIANIRV

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
61 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
62 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
63 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
64 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
75 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
76 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
77 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
82 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
83 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
88 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
93 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.61
Rhizosphere 98.78
Stem 0
Stem Tuber 0
Unclassified 16.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0000532 3300060353 Bacteria 33889
2 Ga0070683_100000001 3300005329 Bacteria 529385
3 Ga0070689_100209834 3300005340 Unclassified 1593
4 Ga0070675_100299968 3300005354 Unclassified 1415
5 Ga0070673_100023843 3300005364 Bacteria 4476
6 Ga0070673_100120963 3300005364 Bacteria 2184
7 Ga0070673_100405578 3300005364 Unclassified 1220
8 Ga0070667_100272741 3300005367 Bacteria 1517
9 Ga0070709_10027431 3300005434 Bacteria 3386
10 Ga0070709_10274159 3300005434 Unclassified 1223
11 Ga0070713_100001558 3300005436 Bacteria 14667
12 Ga0070706_100138548 3300005467 Bacteria 2271
13 Ga0070707_100013663 3300005468 Bacteria 7604
14 Ga0070684_100000060 3300005535 Bacteria 70786
15 Ga0070665_100187017 3300005548 Bacteria 2072
16 Ga0070704_100279135 3300005549 Bacteria 1383
17 Ga0068855_100043805 3300005563 Bacteria 5298
18 Ga0068852_100074569 3300005616 Bacteria 2989
19 Ga0068859_100257722 3300005617 Bacteria 1835
20 Ga0068864_100291070 3300005618 Bacteria 1527
21 Ga0068863_100019003 3300005841 Bacteria 6577
22 Ga0068858_100316872 3300005842 Bacteria 1490
23 Ga0070717_10026858 3300006028 Bacteria 4598
24 Ga0068871_100135916 3300006358 Bacteria 2088
25 Ga0075430_100419280 3300006846 Unclassified 1105
26 Ga0075431_100002844 3300006847 Bacteria 16745
27 Ga0075431_100057354 3300006847 Bacteria 4017
28 Ga0075434_100009365 3300006871 Bacteria 9130
29 Ga0097620_100257734 3300006931 Bacteria 1835
30 Ga0075435_100008208 3300007076 Bacteria 7480
31 Ga0105240_10000167 3300009093 Bacteria 133279
32 Ga0105240_10173783 3300009093 Bacteria 2549
33 Ga0105240_10271854 3300009093 Unclassified 1951
34 Ga0105240_10502626 3300009093 Unclassified 1348
35 Ga0111539_10058333 3300009094 Bacteria 4580
36 Ga0105245_10329180 3300009098 Bacteria 1507
37 Ga0105247_10098246 3300009101 Unclassified 1869
38 Ga0114129_10040379 3300009147 Bacteria 6577
39 Ga0114129_10303896 3300009147 Bacteria 2125
40 Ga0114129_10341803 3300009147 Unclassified 1985
41 Ga0105248_10013559 3300009177 Bacteria 8974
42 Ga0105248_10056088 3300009177 Bacteria 4420
43 Ga0105248_10064982 3300009177 Unclassified 4096
44 Ga0105237_10001573 3300009545 Bacteria 29724
45 Ga0105237_10017394 3300009545 Bacteria 7454
46 Ga0105237_10113089 3300009545 Bacteria 2707
47 Ga0105237_10318014 3300009545 Bacteria 1560
48 Ga0105238_10124312 3300009551 Bacteria 2559
49 Ga0105238_10144368 3300009551 Bacteria 2357
50 Ga0105238_10279347 3300009551 Bacteria 1651
51 Ga0105238_10509362 3300009551 Unclassified 1205
52 Ga0105249_10155976 3300009553 Bacteria 2202
53 Ga0105249_10240264 3300009553 Bacteria 1790
54 Ga0157369_10111796 3300013105 Bacteria 2903
55 Ga0157369_10141144 3300013105 Bacteria 2549
56 Ga0157369_10406297 3300013105 Bacteria 1412
57 Ga0157374_10621648 3300013296 Unclassified 1091
58 Ga0157372_10270728 3300013307 Bacteria 1973
59 Ga0157375_10545961 3300013308 Bacteria 1321
60 Ga0163163_10025396 3300014325 Bacteria 5648
61 Ga0163163_10058077 3300014325 Bacteria 3825
62 Ga0207699_10031260 3300025906 Bacteria 2987
63 Ga0207707_10170069 3300025912 Bacteria 1905
64 Ga0207695_10002536 3300025913 Bacteria 26833
65 Ga0207695_10002622 3300025913 Bacteria 26322
66 Ga0207695_10085474 3300025913 Bacteria 3183
67 Ga0207695_10174225 3300025913 Bacteria 2074
68 Ga0207646_10002428 3300025922 Bacteria 21990
69 Ga0207694_10079894 3300025924 Bacteria 2566
70 Ga0207694_10094437 3300025924 Unclassified 2363
71 Ga0207694_10163142 3300025924 Unclassified 1801
72 Ga0207700_10001818 3300025928 Bacteria 12128
73 Ga0207700_10208320 3300025928 Bacteria 1651
74 Ga0207711_10057627 3300025941 Unclassified 3340
75 Ga0207711_10209856 3300025941 Bacteria 1779
76 Ga0207711_10245195 3300025941 Bacteria 1644
77 Ga0207661_10000005 3300025944 Bacteria 557888
78 Ga0207661_10089379 3300025944 Bacteria 2563
79 Ga0207661_10184303 3300025944 Bacteria 1826
80 Ga0207661_10329235 3300025944 Bacteria 1375
81 Ga0207667_10054077 3300025949 Bacteria 4223
82 Ga0207667_10116877 3300025949 Bacteria 2748
83 Ga0207651_10008873 3300025960 Bacteria 5460
84 Ga0207712_10057780 3300025961 Bacteria 2739
85 Ga0207703_10294458 3300026035 Bacteria 1478
86 Ga0207641_10058365 3300026088 Bacteria 3284
87 Ga0207676_10105427 3300026095 Bacteria 2347
88 Ga0207676_10203013 3300026095 Bacteria 1753
89 Ga0207675_100789809 3300026118 Bacteria 962
90 Ga0207698_10098795 3300026142 Bacteria 2413
91 Ga0268266_10123493 3300028379 Bacteria 2307
92 Ga0268266_10156985 3300028379 Bacteria 2056
93 Ga0265323_10004676 3300028653 Bacteria 5874
94 Ga0265316_10051242 3300031344 Bacteria 3243
95 Ga0265316_10083234 3300031344 Bacteria 2451
96 Ga0265316_10105600 3300031344 Unclassified 2137
97 Ga0265316_10120894 3300031344 Unclassified 1978
98 Ga0373926_0020986 3300035083 Bacteria 2259
99 Ga0373954_0027777 3300035118 Bacteria 2599
100 Ga0373943_0197158 3300035170 Bacteria 1113
101 Ga0373943_0246274 3300035170 Unclassified 1003
102 Ga0373946_0016404 3300035171 Bacteria 2822
103 Ga0373931_0126568 3300035691 Unclassified 1466
104 Ga0373935_0104775 3300035692 Bacteria 1870
105 Ga0373927_0000493 3300035695 Bacteria 29996
106 Ga0373927_0001324 3300035695 Bacteria 18700
107 Ga0373927_0023423 3300035695 Bacteria 4044
108 Ga0373947_0008072 3300035725 Bacteria 6070
109 Ga0373937_0044222 3300036401 Bacteria 4067
110 Ga0373937_0048697 3300036401 Bacteria 3880
111 Ga0373937_0397879 3300036401 Bacteria 1307
112 Ga0373925_0002508 3300037068 Bacteria 14667
113 Ga0436364_1132066 3300037853 Unclassified 2871
114 Ga0451576_0087586 3300045051 Bacteria 3239
115 Ga0451576_0441395 3300045051 Bacteria 1366
116 Ga0451576_0660420 3300045051 Unclassified 1099
117 Ga0495592_0024190 3300046454 Bacteria 4617
118 Ga0495592_0050848 3300046454 Bacteria 3079
119 Ga0495651_0005297 3300046462 Bacteria 9835
120 Ga0495580_0001940 3300046472 Bacteria 18176
121 Ga0495580_0086839 3300046472 Bacteria 2179
122 Ga0495664_0006900 3300046477 Bacteria 6285
123 Ga0495664_0044659 3300046477 Unclassified 2626
124 Ga0495608_0008782 3300046511 Bacteria 7070
125 Ga0495618_0008164 3300046514 Bacteria 6343
126 Ga0495628_0008310 3300046516 Bacteria 8917
127 Ga0495628_0117320 3300046516 Bacteria 2044
128 Ga0495630_0032888 3300046517 Bacteria 3866
129 Ga0495652_0009330 3300046529 Bacteria 8918
130 Ga0495665_0075108 3300046531 Bacteria 1779
131 Ga0495665_0081954 3300046531 Bacteria 1696
132 Ga0495586_0053835 3300046535 Bacteria 2180
133 Ga0495586_0058397 3300046535 Bacteria 2095
134 Ga0495587_0008773 3300046536 Bacteria 6486
135 Ga0495645_0002072 3300046543 Bacteria 13626
136 Ga0495645_0044132 3300046543 Bacteria 3252
137 Ga0495645_0049654 3300046543 Bacteria 3055
138 Ga0495645_0131384 3300046543 Unclassified 1754
139 Ga0495634_0018360 3300046642 Bacteria 4980
140 Ga0495635_0081323 3300046663 Bacteria 2217
141 Ga0495599_0011911 3300046678 Bacteria 5351
142 Ga0495623_0035877 3300046679 Bacteria 3178
143 Ga0495623_0048016 3300046679 Bacteria 2708
144 Ga0495623_0187652 3300046679 Bacteria 1197
145 Ga0495613_0060730 3300046689 Bacteria 2768
146 Ga0495604_0066736 3300047317 Bacteria 2736
147 Ga0495674_0006557 3300047319 Bacteria 11169
148 Ga0495674_0037518 3300047319 Bacteria 4355
149 Ga0495674_0097804 3300047319 Bacteria 2500
150 Ga0495684_0013967 3300047471 Bacteria 6177
151 Ga0495684_0017605 3300047471 Bacteria 5503
152 Ga0495684_0053199 3300047471 Bacteria 3088
153 Ga0495602_0016018 3300048088 Bacteria 7547
154 Ga0495602_0260048 3300048088 Bacteria 1288
155 Ga0495602_0337403 3300048088 Unclassified 1091
156 Ga0496115_0341464 3300048918 Unclassified 1222
157 nmdc:mga05p37_112025_c1 3300050507 Unclassified 3355
158 nmdc:mga06r32_13882_c1 3300050510 Bacteria 7309
159 nmdc:mga06r32_23793_c1 3300050510 Bacteria 5674
160 nmdc:mga08y16_446954_c1 3300050511 Bacteria 1318
161 nmdc:mga0n895_15441_c1 3300050512 Bacteria 6963
162 nmdc:mga0rr50_159121_c1 3300050513 Bacteria 1832
163 nmdc:mga0rr50_596600_c1 3300050513 Bacteria 941
164 nmdc:mga0a205_40170_c1 3300050515 Unclassified 4503
165 Ga0501082_0000532
166 Ga0070683_100000001
167 Ga0070689_100209834
168 Ga0070675_100299968
169 Ga0070673_100023843
170 Ga0070673_100120963
171 Ga0070673_100405578
172 Ga0070667_100272741
173 Ga0070709_10027431
174 Ga0070709_10274159
175 Ga0070713_100001558
176 Ga0070706_100138548
177 Ga0070707_100013663
178 Ga0070684_100000060
179 Ga0070665_100187017
180 Ga0070704_100279135
181 Ga0068855_100043805
182 Ga0068852_100074569
183 Ga0068859_100257722
184 Ga0068864_100291070
185 Ga0068863_100019003
186 Ga0068858_100316872
187 Ga0070717_10026858
188 Ga0068871_100135916
189 Ga0075430_100419280
190 Ga0075431_100002844
191 Ga0075431_100057354
192 Ga0075434_100009365
193 Ga0097620_100257734
194 Ga0075435_100008208
195 Ga0105240_10000167
196 Ga0105240_10173783
197 Ga0105240_10271854
198 Ga0105240_10502626
199 Ga0111539_10058333
200 Ga0105245_10329180
201 Ga0105247_10098246
202 Ga0114129_10040379
203 Ga0114129_10303896
204 Ga0114129_10341803
205 Ga0105248_10013559
206 Ga0105248_10056088
207 Ga0105248_10064982
208 Ga0105237_10001573
209 Ga0105237_10017394
210 Ga0105237_10113089
211 Ga0105237_10318014
212 Ga0105238_10124312
213 Ga0105238_10144368
214 Ga0105238_10279347
215 Ga0105238_10509362
216 Ga0105249_10155976
217 Ga0105249_10240264
218 Ga0157369_10111796
219 Ga0157369_10141144
220 Ga0157369_10406297
221 Ga0157374_10621648
222 Ga0157372_10270728
223 Ga0157375_10545961
224 Ga0163163_10025396
225 Ga0163163_10058077
226 Ga0207699_10031260
227 Ga0207707_10170069
228 Ga0207695_10002536
229 Ga0207695_10002622
230 Ga0207695_10085474
231 Ga0207695_10174225
232 Ga0207646_10002428
233 Ga0207694_10079894
234 Ga0207694_10094437
235 Ga0207694_10163142
236 Ga0207700_10001818
237 Ga0207700_10208320
238 Ga0207711_10057627
239 Ga0207711_10209856
240 Ga0207711_10245195
241 Ga0207661_10000005
242 Ga0207661_10089379
243 Ga0207661_10184303
244 Ga0207661_10329235
245 Ga0207667_10054077
246 Ga0207667_10116877
247 Ga0207651_10008873
248 Ga0207712_10057780
249 Ga0207703_10294458
250 Ga0207641_10058365
251 Ga0207676_10105427
252 Ga0207676_10203013
253 Ga0207675_100789809
254 Ga0207698_10098795
255 Ga0268266_10123493
256 Ga0268266_10156985
257 Ga0265323_10004676
258 Ga0265316_10051242
259 Ga0265316_10083234
260 Ga0265316_10105600
261 Ga0265316_10120894
262 Ga0373926_0020986
263 Ga0373954_0027777
264 Ga0373943_0197158
265 Ga0373943_0246274
266 Ga0373946_0016404
267 Ga0373931_0126568
268 Ga0373935_0104775
269 Ga0373927_0000493
270 Ga0373927_0001324
271 Ga0373927_0023423
272 Ga0373947_0008072
273 Ga0373937_0044222
274 Ga0373937_0048697
275 Ga0373937_0397879
276 Ga0373925_0002508
277 Ga0436364_1132066
278 Ga0451576_0087586
279 Ga0451576_0441395
280 Ga0451576_0660420
281 Ga0495592_0024190
282 Ga0495592_0050848
283 Ga0495651_0005297
284 Ga0495580_0001940
285 Ga0495580_0086839
286 Ga0495664_0006900
287 Ga0495664_0044659
288 Ga0495608_0008782
289 Ga0495618_0008164
290 Ga0495628_0008310
291 Ga0495628_0117320
292 Ga0495630_0032888
293 Ga0495652_0009330
294 Ga0495665_0075108
295 Ga0495665_0081954
296 Ga0495586_0053835
297 Ga0495586_0058397
298 Ga0495587_0008773
299 Ga0495645_0002072
300 Ga0495645_0044132
301 Ga0495645_0049654
302 Ga0495645_0131384
303 Ga0495634_0018360
304 Ga0495635_0081323
305 Ga0495599_0011911
306 Ga0495623_0035877
307 Ga0495623_0048016
308 Ga0495623_0187652
309 Ga0495613_0060730
310 Ga0495604_0066736
311 Ga0495674_0006557
312 Ga0495674_0037518
313 Ga0495674_0097804
314 Ga0495684_0013967
315 Ga0495684_0017605
316 Ga0495684_0053199
317 Ga0495602_0016018
318 Ga0495602_0260048
319 Ga0495602_0337403
320 Ga0496115_0341464
321 nmdc:mga05p37_112025_c1
322 nmdc:mga06r32_13882_c1
323 nmdc:mga06r32_23793_c1
324 nmdc:mga08y16_446954_c1
325 nmdc:mga0n895_15441_c1
326 nmdc:mga0rr50_159121_c1
327 nmdc:mga0rr50_596600_c1
328 nmdc:mga0a205_40170_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

190

316

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.8116 154 256
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.8051 154 256
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.7958 154 267
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.7949 154 261
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.7933 154 261
ID Description Score Start End Superfamily
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8372 161 280 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7912 161 280 1.20.81.30
af_P36646_52_165_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.779 154 265 1.20.81.30
3c1qB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7504 154 269 1.20.81.30
af_P36646_52_165_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7394 154 265 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A6I3D957-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8271 113 264 GO:0005886
AF-A0A535R8U2-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8258 88 328 GO:0005886
AF-A0A349AZU3-F1-model_v4 Secretion system protein 0.8235 99 259 GO:0005886
AF-A0A833D8B8-F1-model_v4 deleted 0.8222 125 296
AF-A0A535R8U2-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8195 88 328 GO:0005886

Map