F244469

General Info

Members Datasets Scaffolds Average Seq Length
164 123 328 294

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0061781|Ga0466969_0061781_625_1605
Length 326
Sequence LVLTNSKPALDIVQHYSASWFTSITAISREHTMRVFVTGATGFIGSAVVRELIDAGHQVVGLTRSDAGAEALAAVGAEAHHGTLEDLDTLRAGATAADGVIHTAFVHDFSDYAAAAETDRRAIDAIGEKLAGSDRPLVVASGMAVQAPGRLTTEEDAVDPNFPRASEQTALPLASRGVRVSVLRLPPSVHGKGDHGFVPHLISTARAKGVSAYPGDGSNRWPAVHRLDAARLFRLALENAPAGARLHAVGDQGIPVRDIAEVIGRHLGLPVNSIAAEQAFAHFGFIGGVFAMDIAASSTLTQSQLDWHPSHPDLIADLEEGHYFKD

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
32 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
33 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
48 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
49 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
50 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
51 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
52 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
53 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
54 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
57 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
58 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
66 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
72 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
73 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
74 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
75 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
81 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
88 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
89 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
90 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
91 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
92 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
108 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
109 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
110 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
111 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
112 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
113 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
114 2558860280 Kutzneria sp. 744 Isolate Unclassified
115 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
116 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
117 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
118 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
119 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
120 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
121 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
122 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
123 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.68
Metatranscriptomes 0
Isolates 7.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.27
Nodule 4.27
Rhizoplane 4.88
Rhizosphere 79.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0061781 3300044656 Bacteria 1819
2 JGI25406J46586_10035805 3300003203 Bacteria 1808
3 Ga0070668_100000663 3300005347 Bacteria 23311
4 Ga0070713_100046021 3300005436 Bacteria 3578
5 Ga0070710_10030340 3300005437 Bacteria 2908
6 Ga0070700_100281612 3300005441 Bacteria 1206
7 Ga0070708_100012192 3300005445 Bacteria 7009
8 Ga0070708_100025751 3300005445 Bacteria 5031
9 Ga0070663_100005962 3300005455 Bacteria 7293
10 Ga0070706_100024034 3300005467 Bacteria 5611
11 Ga0070707_100033660 3300005468 Bacteria 4886
12 Ga0070698_100450185 3300005471 Bacteria 1223
13 Ga0070699_100004365 3300005518 Bacteria 12493
14 Ga0070697_100003362 3300005536 Bacteria 12292
15 Ga0070697_100086891 3300005536 Bacteria 2581
16 Ga0070697_100227882 3300005536 Bacteria 1589
17 Ga0068853_100143062 3300005539 Bacteria 2148
18 Ga0070665_100005024 3300005548 Bacteria 13724
19 Ga0068856_100094820 3300005614 Bacteria 2971
20 Ga0068859_100756775 3300005617 Bacteria 1060
21 Ga0068863_100220150 3300005841 Bacteria 1829
22 Ga0081455_10000487 3300005937 Bacteria 51494
23 Ga0081539_10000682 3300005985 Bacteria 67986
24 Ga0081539_10017050 3300005985 Bacteria 5131
25 Ga0070717_10003711 3300006028 Bacteria 10973
26 Ga0070717_10042946 3300006028 Bacteria 3688
27 Ga0070717_10052751 3300006028 Bacteria 3351
28 Ga0070717_10150235 3300006028 Bacteria 2015
29 Ga0075365_10009587 3300006038 Bacteria 5580
30 Ga0075363_100005978 3300006048 Bacteria 5486
31 Ga0097620_100756622 3300006931 Bacteria 1060
32 Ga0079104_1000854 3300006946 Bacteria 25347
33 Ga0105240_10000570 3300009093 Bacteria 68288
34 Ga0105241_10002835 3300009174 Bacteria 12951
35 Ga0105248_10001020 3300009177 Bacteria 30975
36 Ga0105237_10007395 3300009545 Bacteria 12027
37 Ga0105237_10071618 3300009545 Bacteria 3461
38 Ga0105249_10134169 3300009553 Bacteria 2367
39 Ga0213876_10015858 3300021384 Bacteria 3987
40 Ga0224572_1001142 3300024225 Bacteria 3768
41 Ga0224572_1012217 3300024225 Bacteria 1629
42 Ga0207688_10000123 3300025901 Bacteria 31911
43 Ga0207684_10004130 3300025910 Bacteria 13824
44 Ga0207684_10010260 3300025910 Bacteria 8245
45 Ga0207684_10143772 3300025910 Bacteria 2051
46 Ga0207695_10000775 3300025913 Bacteria 60574
47 Ga0207671_10006780 3300025914 Bacteria 10123
48 Ga0207671_10008428 3300025914 Bacteria 8742
49 Ga0207693_10158730 3300025915 Bacteria 1779
50 Ga0207646_10002997 3300025922 Bacteria 19495
51 Ga0207646_10013134 3300025922 Bacteria 7927
52 Ga0207681_10005681 3300025923 Bacteria 7658
53 Ga0207665_10022972 3300025939 Bacteria 4106
54 Ga0207665_10096842 3300025939 Bacteria 2053
55 Ga0207665_10246448 3300025939 Bacteria 1318
56 Ga0207668_10175138 3300025972 Bacteria 1686
57 Ga0207639_10211880 3300026041 Bacteria 1668
58 Ga0207678_10005072 3300026067 Bacteria 11808
59 Ga0207702_10106244 3300026078 Bacteria 2487
60 Ga0209281_1000355 3300027111 Bacteria 75566
61 Ga0268266_10003815 3300028379 Bacteria 14743
62 Ga0307517_10056296 3300028786 Bacteria 3840
63 Ga0307509_10159318 3300031507 Bacteria 2158
64 Ga0373955_0010845 3300035172 Bacteria 4322
65 Ga0373955_0116887 3300035172 Bacteria 1547
66 Ga0373937_0016129 3300036401 Bacteria 6627
67 Ga0395899_0042147 3300037312 Bacteria 3408
68 Ga0436365_1164113 3300039437 Bacteria 15972
69 Ga0436363_0217381 3300039450 Bacteria 1291
70 Ga0466969_0017860 3300044656 Bacteria 3700
71 Ga0466969_0054270 3300044656 Bacteria 1963
72 Ga0466966_0007087 3300044684 Bacteria 7430
73 Ga0466966_0119316 3300044684 Bacteria 1621
74 Ga0466961_0060512 3300044693 Bacteria 2408
75 Ga0466963_0012839 3300044694 Bacteria 5132
76 Ga0466971_0006671 3300044719 Bacteria 5023
77 Ga0466971_0089879 3300044719 Bacteria 1406
78 Ga0466968_0002047 3300044735 Bacteria 7335
79 Ga0466970_0010001 3300044765 Bacteria 4804
80 Ga0466957_0027946 3300044842 Bacteria 3355
81 Ga0466960_0000032 3300044901 Bacteria 46666
82 Ga0466959_0019842 3300045049 Bacteria 4946
83 Ga0466959_0358156 3300045049 Bacteria 994
84 Ga0466958_0044169 3300045836 Bacteria 2685
85 Ga0466967_0688368 3300045976 Bacteria 1012
86 Ga0495592_0230288 3300046454 Bacteria 1234
87 Ga0495603_0194672 3300046455 Bacteria 1172
88 Ga0495629_0044064 3300046459 Bacteria 3132
89 Ga0495651_0079064 3300046462 Bacteria 2486
90 Ga0495653_0018589 3300046463 Bacteria 5641
91 Ga0495653_0117027 3300046463 Bacteria 1905
92 Ga0495608_0043376 3300046511 Bacteria 3005
93 Ga0495618_0112274 3300046514 Bacteria 1745
94 Ga0495652_0225457 3300046529 Bacteria 1405
95 Ga0495635_0016352 3300046663 Bacteria 5180
96 Ga0495657_0006739 3300046675 Bacteria 8955
97 Ga0495646_0145609 3300046680 Bacteria 1321
98 Ga0495613_0166149 3300046689 Bacteria 1568
99 Ga0495600_0007961 3300046809 Bacteria 6494
100 Ga0495636_0030601 3300047318 Bacteria 2202
101 Ga0495680_0013515 3300047322 Bacteria 7119
102 Ga0495684_0015437 3300047471 Bacteria 5877
103 Ga0495684_0026931 3300047471 Bacteria 4417
104 Ga0495593_0183779 3300047673 Bacteria 1053
105 Ga0496100_0194629 3300048903 Bacteria 1474
106 Ga0496101_0381525 3300048904 Bacteria 1109
107 Ga0496104_0022223 3300048907 Bacteria 5826
108 Ga0496105_0159614 3300048908 Bacteria 1851
109 Ga0496107_0234474 3300048910 Bacteria 1366
110 Ga0496113_0071343 3300048916 Bacteria 2642
111 Ga0496113_0362581 3300048916 Bacteria 1163
112 Ga0496115_0066285 3300048918 Bacteria 2918
113 Ga0496122_0161172 3300048925 Bacteria 1367
114 Ga0496123_0020339 3300048926 Bacteria 5195
115 Ga0496126_0080579 3300048929 Bacteria 2881
116 Ga0495682_0029012 3300049460 Bacteria 2049
117 Ga0501031_0069187 3300049568 Bacteria 2299
118 Ga0501032_0029105 3300049569 Bacteria 3793
119 Ga0501032_0051796 3300049569 Bacteria 2767
120 Ga0501033_0007475 3300049570 Bacteria 8507
121 Ga0501033_0015928 3300049570 Bacteria 5695
122 Ga0501034_0026183 3300049571 Bacteria 5939
123 Ga0501034_0043122 3300049571 Bacteria 4566
124 Ga0501036_0086576 3300049572 Bacteria 2648
125 Ga0501036_0323505 3300049572 Bacteria 1288
126 Ga0501036_0418261 3300049572 Bacteria 1117
127 Ga0501037_0006633 3300049573 Bacteria 8463
128 Ga0501037_0013748 3300049573 Bacteria 5963
129 Ga0501038_0006308 3300049574 Bacteria 10967
130 Ga0501038_0034785 3300049574 Bacteria 4427
131 Ga0501042_0007622 3300049578 Bacteria 7102
132 Ga0501043_0005876 3300049579 Bacteria 9872
133 Ga0501043_0013372 3300049579 Bacteria 6418
134 Ga0501047_0031723 3300049581 Bacteria 5096
135 Ga0501047_0035295 3300049581 Bacteria 4831
136 Ga0501047_0040497 3300049581 Bacteria 4506
137 Ga0501047_0059567 3300049581 Bacteria 3686
138 Ga0501047_0140405 3300049581 Bacteria 2294
139 Ga0501048_0005495 3300049582 Bacteria 9643
140 Ga0501070_0005043 3300049586 Bacteria 11263
141 Ga0501070_0113536 3300049586 Bacteria 2239
142 Ga0501035_0177002 3300049822 Bacteria 1839
143 Ga0501044_0008593 3300049823 Bacteria 11184
144 Ga0501044_0015668 3300049823 Bacteria 8164
145 Ga0501044_0113362 3300049823 Bacteria 2718
146 Ga0501044_0345382 3300049823 Bacteria 1409
147 Ga0501044_0999181 3300049823 Bacteria 708
148 nmdc:mga03n38_79623_c1 3300050490 Bacteria 1537
149 nmdc:mga0yw44_685_c1 3300050492 Bacteria 12387
150 nmdc:mga07m45_6000_c1 3300050496 Bacteria 6110
151 Ga0500646_0008878 3300053090 Bacteria 2574
152 Ga0500618_010361 3300053125 Bacteria 2503
153 2551713507 2551306089 Bacteria 7162724
154 2558906440 2558860112 Bacteria 9931328
155 2559422762 2558860280 Bacteria 11429938
156 2819686366 2818991461 Bacteria 7026071
157 2833712944 2833709550 Bacteria 4008291
158 2891400319 2891395885 Bacteria 9251614
159 2916001686 2916000859 Bacteria 6865702
160 2919452733 2919450847 Bacteria 5631160
161 2924180578 2924179722 Bacteria 6843264
162 2964702118 2964698721 Bacteria 6765331
163 2970096904 2970095765 Bacteria 6936963
164 8056451348 8056447290 Bacteria 7680491
165 Ga0466969_0061781
166 JGI25406J46586_10035805
167 Ga0070668_100000663
168 Ga0070713_100046021
169 Ga0070710_10030340
170 Ga0070700_100281612
171 Ga0070708_100012192
172 Ga0070708_100025751
173 Ga0070663_100005962
174 Ga0070706_100024034
175 Ga0070707_100033660
176 Ga0070698_100450185
177 Ga0070699_100004365
178 Ga0070697_100003362
179 Ga0070697_100086891
180 Ga0070697_100227882
181 Ga0068853_100143062
182 Ga0070665_100005024
183 Ga0068856_100094820
184 Ga0068859_100756775
185 Ga0068863_100220150
186 Ga0081455_10000487
187 Ga0081539_10000682
188 Ga0081539_10017050
189 Ga0070717_10003711
190 Ga0070717_10042946
191 Ga0070717_10052751
192 Ga0070717_10150235
193 Ga0075365_10009587
194 Ga0075363_100005978
195 Ga0097620_100756622
196 Ga0079104_1000854
197 Ga0105240_10000570
198 Ga0105241_10002835
199 Ga0105248_10001020
200 Ga0105237_10007395
201 Ga0105237_10071618
202 Ga0105249_10134169
203 Ga0213876_10015858
204 Ga0224572_1001142
205 Ga0224572_1012217
206 Ga0207688_10000123
207 Ga0207684_10004130
208 Ga0207684_10010260
209 Ga0207684_10143772
210 Ga0207695_10000775
211 Ga0207671_10006780
212 Ga0207671_10008428
213 Ga0207693_10158730
214 Ga0207646_10002997
215 Ga0207646_10013134
216 Ga0207681_10005681
217 Ga0207665_10022972
218 Ga0207665_10096842
219 Ga0207665_10246448
220 Ga0207668_10175138
221 Ga0207639_10211880
222 Ga0207678_10005072
223 Ga0207702_10106244
224 Ga0209281_1000355
225 Ga0268266_10003815
226 Ga0307517_10056296
227 Ga0307509_10159318
228 Ga0373955_0010845
229 Ga0373955_0116887
230 Ga0373937_0016129
231 Ga0395899_0042147
232 Ga0436365_1164113
233 Ga0436363_0217381
234 Ga0466969_0017860
235 Ga0466969_0054270
236 Ga0466966_0007087
237 Ga0466966_0119316
238 Ga0466961_0060512
239 Ga0466963_0012839
240 Ga0466971_0006671
241 Ga0466971_0089879
242 Ga0466968_0002047
243 Ga0466970_0010001
244 Ga0466957_0027946
245 Ga0466960_0000032
246 Ga0466959_0019842
247 Ga0466959_0358156
248 Ga0466958_0044169
249 Ga0466967_0688368
250 Ga0495592_0230288
251 Ga0495603_0194672
252 Ga0495629_0044064
253 Ga0495651_0079064
254 Ga0495653_0018589
255 Ga0495653_0117027
256 Ga0495608_0043376
257 Ga0495618_0112274
258 Ga0495652_0225457
259 Ga0495635_0016352
260 Ga0495657_0006739
261 Ga0495646_0145609
262 Ga0495613_0166149
263 Ga0495600_0007961
264 Ga0495636_0030601
265 Ga0495680_0013515
266 Ga0495684_0015437
267 Ga0495684_0026931
268 Ga0495593_0183779
269 Ga0496100_0194629
270 Ga0496101_0381525
271 Ga0496104_0022223
272 Ga0496105_0159614
273 Ga0496107_0234474
274 Ga0496113_0071343
275 Ga0496113_0362581
276 Ga0496115_0066285
277 Ga0496122_0161172
278 Ga0496123_0020339
279 Ga0496126_0080579
280 Ga0495682_0029012
281 Ga0501031_0069187
282 Ga0501032_0029105
283 Ga0501032_0051796
284 Ga0501033_0007475
285 Ga0501033_0015928
286 Ga0501034_0026183
287 Ga0501034_0043122
288 Ga0501036_0086576
289 Ga0501036_0323505
290 Ga0501036_0418261
291 Ga0501037_0006633
292 Ga0501037_0013748
293 Ga0501038_0006308
294 Ga0501038_0034785
295 Ga0501042_0007622
296 Ga0501043_0005876
297 Ga0501043_0013372
298 Ga0501047_0031723
299 Ga0501047_0035295
300 Ga0501047_0040497
301 Ga0501047_0059567
302 Ga0501047_0140405
303 Ga0501048_0005495
304 Ga0501070_0005043
305 Ga0501070_0113536
306 Ga0501035_0177002
307 Ga0501044_0008593
308 Ga0501044_0015668
309 Ga0501044_0113362
310 Ga0501044_0345382
311 Ga0501044_0999181
312 nmdc:mga03n38_79623_c1
313 nmdc:mga0yw44_685_c1
314 nmdc:mga07m45_6000_c1
315 Ga0500646_0008878
316 Ga0500618_010361
317 2551713507
318 2558906440
319 2559422762
320 2819686366
321 2833712944
322 2891400319
323 2916001686
324 2919452733
325 2924180578
326 2964702118
327 2970096904
328 8056451348

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

36

124

0.91

PF07993

NAD_binding_4

Male sterility protein

37

102

0.87

PF05368

NmrA

NmrA-like family

35

132

0.83

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

35

249

0.79

PF13460

NAD_binding_10

NAD(P)H-binding

39

192

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r6d-assembly1.cif.gz_A-2 crystal structure of desiv double mutant (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with nad and dau bound 0.7803 1 262
6bi4-assembly2.cif.gz_C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.7694 1 262
6bi4-assembly2.cif.gz_B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.7685 1 262
2y05-assembly1.cif.gz_A crystal structure of human leukotriene b4 12-hydroxydehydrogenase in complex with nadp and raloxifene 0.7667 2 62
6d2v-assembly1.cif.gz_A apo structure of terb, an nadp dependent oxidoreductase in the terfestatin biosynthesis pathway 0.7661 2 260
ID Description Score Start End Superfamily
af_Q9Y7K4_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9592 1 229 3.40.50.720
af_Q12177_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9559 1 227 3.40.50.720
af_Q869N3_132_238_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.919 2 40 3.90.180.10
af_Q9Y7K4_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8443 1 229 3.40.50.720
af_Q12177_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8282 1 227 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A023XEK3-F1-model_v4 deleted 0.9825 55 264
AF-A0A7U9PA47-F1-model_v4 deleted 0.9789 1 266
AF-A0A7V3MJ56-F1-model_v4 3-beta hydroxysteroid dehydrogenase 0.9757 129 266 GO:0004029
GO:0005737
AF-A0A2V9U2A7-F1-model_v4 3-beta hydroxysteroid dehydrogenase 0.975 1 267 GO:0004029
GO:0005737
AF-A0A498DWA3-F1-model_v4 SDR family oxidoreductase 0.9741 1 264 GO:0004029
GO:0005737

Map