F242586
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 163 | 130 | 163 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300049588|Ga0501072_0598797|Ga0501072_0598797_122_619 |
| Length | 165 |
| Sequence | VKVHELKRSQPVGIPAAEAFAFYGDSLNLEPMTPPWLNFRVTTPGPITMRPGTLLEYRLRLHGVPIRWTTQIETWDPPSGFVDIQLKGPYALWEHTHVFEETDGGRSCVIHDRVRYAIPYGPLGALAHVLFVRRDLERIFDYRRDAVARLLAAKAGSGRGSAPPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 15 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 20 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 21 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 22 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 23 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 39 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 58 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 59 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 60 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 61 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 62 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 63 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 64 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 65 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 66 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 67 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 68 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 69 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 98 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 99 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 100 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 101 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 102 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 103 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 104 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 105 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 106 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 107 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 108 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 109 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 110 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 111 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 112 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 113 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 130 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.39 |
| Metatranscriptomes | 0.61 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.61 |
| Nodule | 0 |
| Rhizoplane | 12.27 |
| Rhizosphere | 84.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002007 | 3300001979 | Bacteria | 9300 |
| 2 | Ga0070683_100071562 | 3300005329 | Bacteria | 3236 |
| 3 | Ga0070677_10000276 | 3300005333 | Bacteria | 18000 |
| 4 | Ga0070682_100000017 | 3300005337 | Bacteria | 235228 |
| 5 | Ga0070682_100364841 | 3300005337 | Bacteria | 1081 |
| 6 | Ga0070668_100088271 | 3300005347 | Bacteria | 2441 |
| 7 | Ga0070675_100000008 | 3300005354 | Bacteria | 250004 |
| 8 | Ga0070688_100001412 | 3300005365 | Bacteria | 11970 |
| 9 | Ga0070667_100001841 | 3300005367 | Bacteria | 18881 |
| 10 | Ga0070714_100021793 | 3300005435 | Bacteria | 5245 |
| 11 | Ga0070713_100076481 | 3300005436 | Bacteria | 2843 |
| 12 | Ga0070713_100147417 | 3300005436 | Bacteria | 2090 |
| 13 | Ga0070681_10028122 | 3300005458 | Bacteria | 5653 |
| 14 | Ga0070685_10001592 | 3300005466 | Bacteria | 11970 |
| 15 | Ga0070679_100000247 | 3300005530 | Bacteria | 45331 |
| 16 | Ga0068853_100000161 | 3300005539 | Bacteria | 45752 |
| 17 | Ga0070686_100150316 | 3300005544 | Archaea | 1630 |
| 18 | Ga0070665_100000138 | 3300005548 | Bacteria | 136562 |
| 19 | Ga0070665_100406947 | 3300005548 | Bacteria | 1369 |
| 20 | Ga0068857_100306230 | 3300005577 | Bacteria | 1465 |
| 21 | Ga0068856_100005497 | 3300005614 | Bacteria | 12485 |
| 22 | Ga0068856_100071187 | 3300005614 | Bacteria | 3442 |
| 23 | Ga0068852_100190428 | 3300005616 | Bacteria | 1935 |
| 24 | Ga0068858_100000009 | 3300005842 | Bacteria | 237748 |
| 25 | Ga0068858_100215197 | 3300005842 | Bacteria | 1819 |
| 26 | Ga0068860_100318336 | 3300005843 | Unclassified | 1527 |
| 27 | Ga0068862_100001603 | 3300005844 | Bacteria | 20605 |
| 28 | Ga0081455_10005473 | 3300005937 | Bacteria | 13921 |
| 29 | Ga0070717_10014557 | 3300006028 | Bacteria | 6055 |
| 30 | Ga0070717_10042665 | 3300006028 | Bacteria | 3700 |
| 31 | Ga0070716_100313028 | 3300006173 | Bacteria | 1097 |
| 32 | Ga0105245_10000012 | 3300009098 | Bacteria | 267151 |
| 33 | Ga0105245_10000020 | 3300009098 | Bacteria | 181774 |
| 34 | Ga0105245_10000179 | 3300009098 | Bacteria | 60347 |
| 35 | Ga0105245_10268136 | 3300009098 | Bacteria | 1664 |
| 36 | Ga0105247_10000185 | 3300009101 | Bacteria | 60656 |
| 37 | Ga0105242_10001335 | 3300009176 | Bacteria | 19502 |
| 38 | Ga0105242_10139162 | 3300009176 | Unclassified | 2104 |
| 39 | Ga0105248_10000126 | 3300009177 | Bacteria | 88461 |
| 40 | Ga0105238_10000126 | 3300009551 | Bacteria | 83957 |
| 41 | Ga0105249_10000080 | 3300009553 | Bacteria | 138080 |
| 42 | Ga0105249_10020910 | 3300009553 | Bacteria | 5852 |
| 43 | Ga0105239_10692472 | 3300010375 | Bacteria | 1165 |
| 44 | Ga0157370_10852931 | 3300013104 | Unclassified | 828 |
| 45 | Ga0157369_10000135 | 3300013105 | Bacteria | 105364 |
| 46 | Ga0157374_10007323 | 3300013296 | Bacteria | 9408 |
| 47 | Ga0157378_10512449 | 3300013297 | Bacteria | 1200 |
| 48 | Ga0157379_10005944 | 3300014968 | Bacteria | 10511 |
| 49 | Ga0157379_10006880 | 3300014968 | Bacteria | 9832 |
| 50 | Ga0206356_11761885 | 3300020070 | Bacteria | 1100 |
| 51 | Ga0207682_10000176 | 3300025893 | Bacteria | 29031 |
| 52 | Ga0207710_10000180 | 3300025900 | Bacteria | 63999 |
| 53 | Ga0207707_10035541 | 3300025912 | Bacteria | 4357 |
| 54 | Ga0207652_10000323 | 3300025921 | Bacteria | 49536 |
| 55 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 56 | Ga0207659_10000014 | 3300025926 | Bacteria | 168481 |
| 57 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 58 | Ga0207687_10000013 | 3300025927 | Bacteria | 299826 |
| 59 | Ga0207687_10001076 | 3300025927 | Bacteria | 18525 |
| 60 | Ga0207664_10106826 | 3300025929 | Bacteria | 2322 |
| 61 | Ga0207686_10001163 | 3300025934 | Bacteria | 15181 |
| 62 | Ga0207686_10297790 | 3300025934 | Unclassified | 1197 |
| 63 | Ga0207711_10000024 | 3300025941 | Bacteria | 293596 |
| 64 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 65 | Ga0207668_10073083 | 3300025972 | Bacteria | 2456 |
| 66 | Ga0207677_10000750 | 3300026023 | Bacteria | 18704 |
| 67 | Ga0207703_10000207 | 3300026035 | Bacteria | 68866 |
| 68 | Ga0207703_10179847 | 3300026035 | Bacteria | 1866 |
| 69 | Ga0207639_10000536 | 3300026041 | Bacteria | 26077 |
| 70 | Ga0207702_10048826 | 3300026078 | Archaea | 3570 |
| 71 | Ga0207698_10313438 | 3300026142 | Bacteria | 1466 |
| 72 | Ga0268266_10000047 | 3300028379 | Bacteria | 310996 |
| 73 | Ga0265322_10061728 | 3300028654 | Unclassified | 1063 |
| 74 | Ga0265327_10031036 | 3300031251 | Bacteria | 3009 |
| 75 | Ga0373954_0022518 | 3300035118 | Bacteria | 2859 |
| 76 | Ga0373933_0039995 | 3300035724 | Bacteria | 2760 |
| 77 | Ga0373933_0045774 | 3300035724 | Bacteria | 2596 |
| 78 | Ga0373947_0648055 | 3300035725 | Bacteria | 720 |
| 79 | Ga0373937_0182057 | 3300036401 | Bacteria | 1973 |
| 80 | Ga0373937_0614403 | 3300036401 | Bacteria | 1032 |
| 81 | Ga0451807_2129689 | 3300041486 | Bacteria | 1051 |
| 82 | Ga0451839_1081320 | 3300041496 | Bacteria | 696 |
| 83 | Ga0451853_0959972 | 3300041512 | Bacteria | 5027 |
| 84 | Ga0466963_0000105 | 3300044694 | Bacteria | 30285 |
| 85 | Ga0466963_0209371 | 3300044694 | Bacteria | 1364 |
| 86 | Ga0466957_0000177 | 3300044842 | Bacteria | 28545 |
| 87 | Ga0466967_0381740 | 3300045976 | Bacteria | 1368 |
| 88 | Ga0495592_0251079 | 3300046454 | Bacteria | 1169 |
| 89 | Ga0495629_0008196 | 3300046459 | Bacteria | 7685 |
| 90 | Ga0495629_0049228 | 3300046459 | Bacteria | 2954 |
| 91 | Ga0495629_0369446 | 3300046459 | Bacteria | 977 |
| 92 | Ga0495641_0000029 | 3300046461 | Bacteria | 97259 |
| 93 | Ga0495641_0038515 | 3300046461 | Bacteria | 2233 |
| 94 | Ga0495608_0170306 | 3300046511 | Bacteria | 1381 |
| 95 | Ga0495620_0001094 | 3300046515 | Bacteria | 16561 |
| 96 | Ga0495628_0172715 | 3300046516 | Bacteria | 1638 |
| 97 | Ga0495628_0779352 | 3300046516 | Bacteria | 670 |
| 98 | Ga0495630_0000714 | 3300046517 | Bacteria | 23478 |
| 99 | Ga0495652_0604025 | 3300046529 | Bacteria | 748 |
| 100 | Ga0495665_0290045 | 3300046531 | Unclassified | 839 |
| 101 | Ga0495587_0146612 | 3300046536 | Bacteria | 1346 |
| 102 | Ga0495645_0028882 | 3300046543 | Unclassified | 4031 |
| 103 | Ga0495645_0054395 | 3300046543 | Unclassified | 2908 |
| 104 | Ga0495634_0038811 | 3300046642 | Bacteria | 3245 |
| 105 | Ga0495635_0108864 | 3300046663 | Bacteria | 1893 |
| 106 | Ga0495657_0005566 | 3300046675 | Bacteria | 9943 |
| 107 | Ga0495657_0030285 | 3300046675 | Bacteria | 3792 |
| 108 | Ga0495599_0004060 | 3300046678 | Bacteria | 8622 |
| 109 | Ga0495646_0315113 | 3300046680 | Bacteria | 825 |
| 110 | Ga0495647_0337044 | 3300046681 | Unclassified | 685 |
| 111 | Ga0495658_0245481 | 3300046683 | Bacteria | 1125 |
| 112 | Ga0495669_0000030 | 3300046684 | Bacteria | 102988 |
| 113 | Ga0495613_0190534 | 3300046689 | Bacteria | 1449 |
| 114 | Ga0495624_0000060 | 3300046690 | Bacteria | 69512 |
| 115 | Ga0495649_0001186 | 3300046694 | Bacteria | 20132 |
| 116 | Ga0495604_0300401 | 3300047317 | Bacteria | 1078 |
| 117 | Ga0495676_0000873 | 3300047321 | Bacteria | 25176 |
| 118 | Ga0495676_0062599 | 3300047321 | Bacteria | 2904 |
| 119 | Ga0495679_021643 | 3300047446 | Unclassified | 2215 |
| 120 | Ga0495684_0673609 | 3300047471 | Bacteria | 689 |
| 121 | Ga0495593_0113564 | 3300047673 | Unclassified | 1382 |
| 122 | Ga0495602_0010203 | 3300048088 | Bacteria | 9748 |
| 123 | Ga0496100_0000010 | 3300048903 | Bacteria | 205204 |
| 124 | Ga0496100_0854405 | 3300048903 | Unclassified | 714 |
| 125 | Ga0496101_0000025 | 3300048904 | Bacteria | 205204 |
| 126 | Ga0496103_0320509 | 3300048906 | Unclassified | 997 |
| 127 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 128 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 129 | Ga0496105_0215346 | 3300048908 | Bacteria | 1565 |
| 130 | Ga0496106_0000012 | 3300048909 | Bacteria | 205158 |
| 131 | Ga0496107_0000010 | 3300048910 | Bacteria | 205188 |
| 132 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 133 | Ga0496108_0354215 | 3300048911 | Bacteria | 1281 |
| 134 | Ga0496109_0000004 | 3300048912 | Bacteria | 404818 |
| 135 | Ga0496110_0051869 | 3300048913 | Bacteria | 3605 |
| 136 | Ga0496111_0009743 | 3300048914 | Bacteria | 6421 |
| 137 | Ga0496112_0191958 | 3300048915 | Bacteria | 2004 |
| 138 | Ga0496112_0279967 | 3300048915 | Unclassified | 1615 |
| 139 | Ga0496113_0259115 | 3300048916 | Bacteria | 1389 |
| 140 | Ga0496113_0422866 | 3300048916 | Bacteria | 1070 |
| 141 | Ga0496114_0003890 | 3300048917 | Bacteria | 11513 |
| 142 | Ga0496121_0033761 | 3300048924 | Bacteria | 4623 |
| 143 | Ga0496125_0123137 | 3300048928 | Bacteria | 1844 |
| 144 | Ga0501036_0155866 | 3300049572 | Bacteria | 1926 |
| 145 | Ga0501040_0064024 | 3300049576 | Bacteria | 2531 |
| 146 | Ga0501042_0080044 | 3300049578 | Bacteria | 2341 |
| 147 | Ga0501068_0245931 | 3300049584 | Bacteria | 1139 |
| 148 | Ga0501072_0598797 | 3300049588 | Bacteria | 869 |
| 149 | Ga0501075_0445944 | 3300049591 | Bacteria | 987 |
| 150 | Ga0501076_0106904 | 3300049592 | Bacteria | 2259 |
| 151 | Ga0501076_0685381 | 3300049592 | Unclassified | 846 |
| 152 | Ga0501079_0118646 | 3300049741 | Bacteria | 2057 |
| 153 | Ga0501080_0391141 | 3300049742 | Bacteria | 1252 |
| 154 | Ga0501081_0830372 | 3300049743 | Bacteria | 696 |
| 155 | Ga0501083_0220210 | 3300049744 | Bacteria | 1236 |
| 156 | Ga0501045_0087142 | 3300049824 | Bacteria | 2305 |
| 157 | Ga0495601_0000066 | 3300053077 | Bacteria | 56855 |
| 158 | Ga0495601_0006750 | 3300053077 | Bacteria | 6721 |
| 159 | Ga0495612_0027047 | 3300053078 | Bacteria | 2306 |
| 160 | Ga0495595_0184184 | 3300053084 | Bacteria | 1036 |
| 161 | Ga0495619_0180019 | 3300053085 | Bacteria | 1462 |
| 162 | Ga0500614_001661 | 3300053123 | Bacteria | 5212 |
| 163 | Ga0501084_0058917 | 3300054114 | Bacteria | 3214 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028654 | Ga0265322_10061728 | Ga0265322_100617282 | 137 |
| 2 | 3300031251 | Ga0265327_10031036 | Ga0265327_100310363 | 137 |
| 3 | 3300044694 | Ga0466963_0209371 | Ga0466963_0209371_104_589 | 137 |
| 4 | 3300045976 | Ga0466967_0381740 | Ga0466967_0381740_904_1356 | 137 |
| 5 | 3300005333 | Ga0070677_10000276 | Ga0070677_100002767 | 138 |
| 6 | 3300005337 | Ga0070682_100000017 | Ga0070682_100000017149 | 138 |
| 7 | 3300005367 | Ga0070667_100001841 | Ga0070667_1000018412 | 138 |
| 8 | 3300005435 | Ga0070714_100021793 | Ga0070714_1000217934 | 138 |
| 9 | 3300005436 | Ga0070713_100076481 | Ga0070713_1000764812 | 138 |
| 10 | 3300005842 | Ga0068858_100215197 | Ga0068858_1002151971 | 138 |
| 11 | 3300005843 | Ga0068860_100318336 | Ga0068860_1003183362 | 138 |
| 12 | 3300005844 | Ga0068862_100001603 | Ga0068862_1000016039 | 138 |
| 13 | 3300005937 | Ga0081455_10005473 | Ga0081455_1000547312 | 138 |
| 14 | 3300006028 | Ga0070717_10014557 | Ga0070717_100145572 | 138 |
| 15 | 3300009098 | Ga0105245_10000020 | Ga0105245_10000020122 | 138 |
| 16 | 3300009553 | Ga0105249_10000080 | Ga0105249_10000080100 | 138 |
| 17 | 3300009553 | Ga0105249_10020910 | Ga0105249_100209103 | 138 |
| 18 | 3300014968 | Ga0157379_10005944 | Ga0157379_100059447 | 138 |
| 19 | 3300014968 | Ga0157379_10006880 | Ga0157379_100068808 | 138 |
| 20 | 3300025893 | Ga0207682_10000176 | Ga0207682_1000017623 | 138 |
| 21 | 3300025927 | Ga0207687_10000013 | Ga0207687_10000013164 | 138 |
| 22 | 3300025929 | Ga0207664_10106826 | Ga0207664_101068262 | 138 |
| 23 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007493 | 138 |
| 24 | 3300026035 | Ga0207703_10179847 | Ga0207703_101798473 | 138 |
| 25 | 3300036401 | Ga0373937_0614403 | Ga0373937_0614403_263_712 | 138 |
| 26 | 3300046459 | Ga0495629_0369446 | Ga0495629_0369446_403_852 | 138 |
| 27 | 3300046515 | Ga0495620_0001094 | Ga0495620_0001094_15332_15787 | 138 |
| 28 | 3300046516 | Ga0495628_0779352 | Ga0495628_0779352_208_657 | 138 |
| 29 | 3300046517 | Ga0495630_0000714 | Ga0495630_0000714_20590_21039 | 138 |
| 30 | 3300046529 | Ga0495652_0604025 | Ga0495652_0604025_251_700 | 138 |
| 31 | 3300046536 | Ga0495587_0146612 | Ga0495587_0146612_165_614 | 138 |
| 32 | 3300046663 | Ga0495635_0108864 | Ga0495635_0108864_742_1191 | 138 |
| 33 | 3300046675 | Ga0495657_0030285 | Ga0495657_0030285_1067_1516 | 138 |
| 34 | 3300046680 | Ga0495646_0315113 | Ga0495646_0315113_27_476 | 138 |
| 35 | 3300046684 | Ga0495669_0000030 | Ga0495669_0000030_87048_87503 | 138 |
| 36 | 3300047321 | Ga0495676_0000873 | Ga0495676_0000873_23829_24284 | 138 |
| 37 | 3300047471 | Ga0495684_0673609 | Ga0495684_0673609_94_543 | 138 |
| 38 | 3300048903 | Ga0496100_0000010 | Ga0496100_0000010_177202_177657 | 138 |
| 39 | 3300048904 | Ga0496101_0000025 | Ga0496101_0000025_177202_177657 | 138 |
| 40 | 3300048907 | Ga0496104_0000009 | Ga0496104_0000009_350897_351352 | 138 |
| 41 | 3300048908 | Ga0496105_0000007 | Ga0496105_0000007_136704_137159 | 138 |
| 42 | 3300048909 | Ga0496106_0000012 | Ga0496106_0000012_27520_27975 | 138 |
| 43 | 3300048910 | Ga0496107_0000010 | Ga0496107_0000010_27532_27987 | 138 |
| 44 | 3300053077 | Ga0495601_0006750 | Ga0495601_0006750_3624_4073 | 138 |
| 45 | 3300053084 | Ga0495595_0184184 | Ga0495595_0184184_257_712 | 138 |
| 46 | 3300053085 | Ga0495619_0180019 | Ga0495619_0180019_413_862 | 138 |
| 47 | 3300005436 | Ga0070713_100147417 | Ga0070713_1001474172 | 139 |
| 48 | 3300006028 | Ga0070717_10042665 | Ga0070717_100426652 | 139 |
| 49 | 3300006173 | Ga0070716_100313028 | Ga0070716_1003130282 | 139 |
| 50 | 3300035118 | Ga0373954_0022518 | Ga0373954_0022518_2038_2505 | 139 |
| 51 | 3300035724 | Ga0373933_0039995 | Ga0373933_0039995_1258_1725 | 139 |
| 52 | 3300046531 | Ga0495665_0290045 | Ga0495665_0290045_44_511 | 139 |
| 53 | 3300046543 | Ga0495645_0028882 | Ga0495645_0028882_500_958 | 139 |
| 54 | 3300046642 | Ga0495634_0038811 | Ga0495634_0038811_2054_2521 | 139 |
| 55 | 3300046675 | Ga0495657_0005566 | Ga0495657_0005566_529_996 | 139 |
| 56 | 3300046689 | Ga0495613_0190534 | Ga0495613_0190534_517_984 | 139 |
| 57 | 3300047317 | Ga0495604_0300401 | Ga0495604_0300401_303_770 | 139 |
| 58 | 3300048088 | Ga0495602_0010203 | Ga0495602_0010203_444_911 | 139 |
| 59 | 3300049572 | Ga0501036_0155866 | Ga0501036_0155866_1212_1670 | 139 |
| 60 | 3300049576 | Ga0501040_0064024 | Ga0501040_0064024_1266_1724 | 139 |
| 61 | 3300049578 | Ga0501042_0080044 | Ga0501042_0080044_527_985 | 139 |
| 62 | 3300049584 | Ga0501068_0245931 | Ga0501068_0245931_603_1064 | 139 |
| 63 | 3300049591 | Ga0501075_0445944 | Ga0501075_0445944_249_707 | 139 |
| 64 | 3300049592 | Ga0501076_0106904 | Ga0501076_0106904_157_615 | 139 |
| 65 | 3300049741 | Ga0501079_0118646 | Ga0501079_0118646_302_760 | 139 |
| 66 | 3300049742 | Ga0501080_0391141 | Ga0501080_0391141_374_832 | 139 |
| 67 | 3300049743 | Ga0501081_0830372 | Ga0501081_0830372_218_676 | 139 |
| 68 | 3300049824 | Ga0501045_0087142 | Ga0501045_0087142_580_1038 | 139 |
| 69 | 3300053077 | Ga0495601_0000066 | Ga0495601_0000066_22715_23134 | 139 |
| 70 | 3300054114 | Ga0501084_0058917 | Ga0501084_0058917_2714_3172 | 139 |
| 71 | 3300001979 | JGI24740J21852_10002007 | JGI24740J21852_1000200713 | 140 |
| 72 | 3300005329 | Ga0070683_100071562 | Ga0070683_1000715624 | 140 |
| 73 | 3300005337 | Ga0070682_100364841 | Ga0070682_1003648412 | 140 |
| 74 | 3300005347 | Ga0070668_100088271 | Ga0070668_1000882714 | 140 |
| 75 | 3300005354 | Ga0070675_100000008 | Ga0070675_100000008213 | 140 |
| 76 | 3300005365 | Ga0070688_100001412 | Ga0070688_1000014129 | 140 |
| 77 | 3300005458 | Ga0070681_10028122 | Ga0070681_100281223 | 140 |
| 78 | 3300005466 | Ga0070685_10001592 | Ga0070685_100015929 | 140 |
| 79 | 3300005530 | Ga0070679_100000247 | Ga0070679_10000024725 | 140 |
| 80 | 3300005539 | Ga0068853_100000161 | Ga0068853_10000016119 | 140 |
| 81 | 3300005544 | Ga0070686_100150316 | Ga0070686_1001503163 | 140 |
| 82 | 3300005548 | Ga0070665_100000138 | Ga0070665_10000013893 | 140 |
| 83 | 3300005548 | Ga0070665_100406947 | Ga0070665_1004069472 | 140 |
| 84 | 3300005577 | Ga0068857_100306230 | Ga0068857_1003062302 | 140 |
| 85 | 3300005614 | Ga0068856_100005497 | Ga0068856_10000549711 | 140 |
| 86 | 3300005614 | Ga0068856_100071187 | Ga0068856_1000711873 | 140 |
| 87 | 3300005616 | Ga0068852_100190428 | Ga0068852_1001904284 | 140 |
| 88 | 3300005842 | Ga0068858_100000009 | Ga0068858_10000000963 | 140 |
| 89 | 3300009098 | Ga0105245_10000012 | Ga0105245_1000001254 | 140 |
| 90 | 3300009098 | Ga0105245_10000179 | Ga0105245_1000017918 | 140 |
| 91 | 3300009098 | Ga0105245_10268136 | Ga0105245_102681362 | 140 |
| 92 | 3300009101 | Ga0105247_10000185 | Ga0105247_1000018545 | 140 |
| 93 | 3300009176 | Ga0105242_10001335 | Ga0105242_1000133519 | 140 |
| 94 | 3300009176 | Ga0105242_10139162 | Ga0105242_101391621 | 140 |
| 95 | 3300009177 | Ga0105248_10000126 | Ga0105248_1000012657 | 140 |
| 96 | 3300009551 | Ga0105238_10000126 | Ga0105238_1000012669 | 140 |
| 97 | 3300010375 | Ga0105239_10692472 | Ga0105239_106924722 | 140 |
| 98 | 3300013104 | Ga0157370_10852931 | Ga0157370_108529312 | 140 |
| 99 | 3300013105 | Ga0157369_10000135 | Ga0157369_1000013585 | 140 |
| 100 | 3300013296 | Ga0157374_10007323 | Ga0157374_100073235 | 140 |
| 101 | 3300013297 | Ga0157378_10512449 | Ga0157378_105124493 | 140 |
| 102 | 3300020070 | Ga0206356_11761885 | Ga0206356_117618853 | 140 |
| 103 | 3300025900 | Ga0207710_10000180 | Ga0207710_1000018032 | 140 |
| 104 | 3300025912 | Ga0207707_10035541 | Ga0207707_100355414 | 140 |
| 105 | 3300025921 | Ga0207652_10000323 | Ga0207652_1000032331 | 140 |
| 106 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004361 | 140 |
| 107 | 3300025926 | Ga0207659_10000014 | Ga0207659_10000014101 | 140 |
| 108 | 3300025927 | Ga0207687_10000011 | Ga0207687_10000011107 | 140 |
| 109 | 3300025927 | Ga0207687_10001076 | Ga0207687_1000107611 | 140 |
| 110 | 3300025934 | Ga0207686_10001163 | Ga0207686_100011635 | 140 |
| 111 | 3300025934 | Ga0207686_10297790 | Ga0207686_102977901 | 140 |
| 112 | 3300025941 | Ga0207711_10000024 | Ga0207711_10000024169 | 140 |
| 113 | 3300025972 | Ga0207668_10073083 | Ga0207668_100730832 | 140 |
| 114 | 3300026023 | Ga0207677_10000750 | Ga0207677_1000075014 | 140 |
| 115 | 3300026035 | Ga0207703_10000207 | Ga0207703_100002079 | 140 |
| 116 | 3300026041 | Ga0207639_10000536 | Ga0207639_1000053621 | 140 |
| 117 | 3300026078 | Ga0207702_10048826 | Ga0207702_1004882610 | 140 |
| 118 | 3300026142 | Ga0207698_10313438 | Ga0207698_103134382 | 140 |
| 119 | 3300028379 | Ga0268266_10000047 | Ga0268266_1000004763 | 140 |
| 120 | 3300035724 | Ga0373933_0045774 | Ga0373933_0045774_421_882 | 140 |
| 121 | 3300035725 | Ga0373947_0648055 | Ga0373947_0648055_73_555 | 140 |
| 122 | 3300036401 | Ga0373937_0182057 | Ga0373937_0182057_645_1106 | 140 |
| 123 | 3300041486 | Ga0451807_2129689 | Ga0451807_2129689_485_949 | 140 |
| 124 | 3300041496 | Ga0451839_1081320 | Ga0451839_1081320_159_647 | 140 |
| 125 | 3300041512 | Ga0451853_0959972 | Ga0451853_0959972_3322_3786 | 140 |
| 126 | 3300044694 | Ga0466963_0000105 | Ga0466963_0000105_1281_1775 | 140 |
| 127 | 3300044842 | Ga0466957_0000177 | Ga0466957_0000177_14851_15315 | 140 |
| 128 | 3300046454 | Ga0495592_0251079 | Ga0495592_0251079_527_997 | 140 |
| 129 | 3300046459 | Ga0495629_0008196 | Ga0495629_0008196_2536_3003 | 140 |
| 130 | 3300046459 | Ga0495629_0049228 | Ga0495629_0049228_1014_1502 | 140 |
| 131 | 3300046461 | Ga0495641_0000029 | Ga0495641_0000029_37593_38057 | 140 |
| 132 | 3300046461 | Ga0495641_0038515 | Ga0495641_0038515_324_788 | 140 |
| 133 | 3300046511 | Ga0495608_0170306 | Ga0495608_0170306_454_918 | 140 |
| 134 | 3300046516 | Ga0495628_0172715 | Ga0495628_0172715_284_748 | 140 |
| 135 | 3300046543 | Ga0495645_0054395 | Ga0495645_0054395_1435_1914 | 140 |
| 136 | 3300046678 | Ga0495599_0004060 | Ga0495599_0004060_1116_1580 | 140 |
| 137 | 3300046681 | Ga0495647_0337044 | Ga0495647_0337044_19_483 | 140 |
| 138 | 3300046683 | Ga0495658_0245481 | Ga0495658_0245481_281_763 | 140 |
| 139 | 3300046690 | Ga0495624_0000060 | Ga0495624_0000060_33131_33595 | 140 |
| 140 | 3300046694 | Ga0495649_0001186 | Ga0495649_0001186_140_583 | 140 |
| 141 | 3300047321 | Ga0495676_0062599 | Ga0495676_0062599_204_686 | 140 |
| 142 | 3300047446 | Ga0495679_021643 | Ga0495679_021643_1130_1594 | 140 |
| 143 | 3300047673 | Ga0495593_0113564 | Ga0495593_0113564_561_1028 | 140 |
| 144 | 3300048903 | Ga0496100_0854405 | Ga0496100_0854405_131_598 | 140 |
| 145 | 3300048906 | Ga0496103_0320509 | Ga0496103_0320509_289_756 | 140 |
| 146 | 3300048908 | Ga0496105_0215346 | Ga0496105_0215346_179_646 | 140 |
| 147 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_788284_788760 | 140 |
| 148 | 3300048911 | Ga0496108_0354215 | Ga0496108_0354215_91_558 | 140 |
| 149 | 3300048912 | Ga0496109_0000004 | Ga0496109_0000004_42095_42571 | 140 |
| 150 | 3300048913 | Ga0496110_0051869 | Ga0496110_0051869_2500_2964 | 140 |
| 151 | 3300048914 | Ga0496111_0009743 | Ga0496111_0009743_4714_5181 | 140 |
| 152 | 3300048915 | Ga0496112_0191958 | Ga0496112_0191958_905_1372 | 140 |
| 153 | 3300048915 | Ga0496112_0279967 | Ga0496112_0279967_144_608 | 140 |
| 154 | 3300048916 | Ga0496113_0259115 | Ga0496113_0259115_437_904 | 140 |
| 155 | 3300048916 | Ga0496113_0422866 | Ga0496113_0422866_10_474 | 140 |
| 156 | 3300048917 | Ga0496114_0003890 | Ga0496114_0003890_9387_9857 | 140 |
| 157 | 3300048924 | Ga0496121_0033761 | Ga0496121_0033761_1227_1712 | 140 |
| 158 | 3300048928 | Ga0496125_0123137 | Ga0496125_0123137_687_1163 | 140 |
| 159 | 3300049588 | Ga0501072_0598797 | Ga0501072_0598797_122_619 | 140 |
| 160 | 3300049592 | Ga0501076_0685381 | Ga0501076_0685381_277_747 | 140 |
| 161 | 3300049744 | Ga0501083_0220210 | Ga0501083_0220210_552_1043 | 140 |
| 162 | 3300053078 | Ga0495612_0027047 | Ga0495612_0027047_22_486 | 140 |
| 163 | 3300053123 | Ga0500614_001661 | Ga0500614_001661_2318_2782 | 140 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d4r-assembly1.cif.gz_A | crystal structure of ttha0849 from thermus thermophilus hb8 | 0.7867 | 2 | 136 |
| 6y3l-assembly1.cif.gz_A | nmr solution structure of the hazelnut allergen cor a 1.0404 | 0.7556 | 1 | 128 |
| 3kay-assembly1.cif.gz_A | crystal structure of abscisic acid receptor pyl1 | 0.7534 | 2 | 135 |
| 5ygv-assembly1.cif.gz_A | crystal structure of the abscisic acid receptor pyr1 in complex with an antagonist | 0.7534 | 2 | 135 |
| 1z94-assembly1.cif.gz_B | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.7524 | 2 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJ05_1_142_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7913 | 1 | 134 | 3.30.530.20 |
| af_Q94K52_78_219_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.786 | 1 | 140 | 3.30.530.20 |
| af_P9WLU7_2_142_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7785 | 1 | 135 | 3.30.530.20 |
| 2d4rA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7743 | 2 | 136 | 3.30.530.20 |
| af_Q8MLL3_83_228_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7535 | 2 | 138 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3L7V0F2-F1-model_v4 | CDP-paratose 2-epimerase | 0.9774 | 3 | 133 |
|
| AF-A0A7V9IHD2-F1-model_v4 | SRPBCC family protein | 0.9762 | 1 | 139 |
|
| AF-A0A7V4AQR6-F1-model_v4 | CDP-paratose 2-epimerase | 0.974 | 1 | 139 |
|
| AF-A0A4P5XQB4-F1-model_v4 | deleted | 0.9719 | 2 | 135 |
|
| AF-A0A7C6DZ04-F1-model_v4 | CDP-paratose 2-epimerase | 0.9713 | 2 | 135 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar