F242586

General Info

Members Datasets Scaffolds Average Seq Length
163 130 163 155

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0598797|Ga0501072_0598797_122_619
Length 165
Sequence VKVHELKRSQPVGIPAAEAFAFYGDSLNLEPMTPPWLNFRVTTPGPITMRPGTLLEYRLRLHGVPIRWTTQIETWDPPSGFVDIQLKGPYALWEHTHVFEETDGGRSCVIHDRVRYAIPYGPLGALAHVLFVRRDLERIFDYRRDAVARLLAAKAGSGRGSAPPR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
60 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
61 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
64 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
65 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
72 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
73 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
74 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
77 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
78 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
79 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
84 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
85 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
96 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
127 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 12.27
Rhizosphere 84.66
Stem 0
Stem Tuber 0
Unclassified 2.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002007 3300001979 Bacteria 9300
2 Ga0070683_100071562 3300005329 Bacteria 3236
3 Ga0070677_10000276 3300005333 Bacteria 18000
4 Ga0070682_100000017 3300005337 Bacteria 235228
5 Ga0070682_100364841 3300005337 Bacteria 1081
6 Ga0070668_100088271 3300005347 Bacteria 2441
7 Ga0070675_100000008 3300005354 Bacteria 250004
8 Ga0070688_100001412 3300005365 Bacteria 11970
9 Ga0070667_100001841 3300005367 Bacteria 18881
10 Ga0070714_100021793 3300005435 Bacteria 5245
11 Ga0070713_100076481 3300005436 Bacteria 2843
12 Ga0070713_100147417 3300005436 Bacteria 2090
13 Ga0070681_10028122 3300005458 Bacteria 5653
14 Ga0070685_10001592 3300005466 Bacteria 11970
15 Ga0070679_100000247 3300005530 Bacteria 45331
16 Ga0068853_100000161 3300005539 Bacteria 45752
17 Ga0070686_100150316 3300005544 Archaea 1630
18 Ga0070665_100000138 3300005548 Bacteria 136562
19 Ga0070665_100406947 3300005548 Bacteria 1369
20 Ga0068857_100306230 3300005577 Bacteria 1465
21 Ga0068856_100005497 3300005614 Bacteria 12485
22 Ga0068856_100071187 3300005614 Bacteria 3442
23 Ga0068852_100190428 3300005616 Bacteria 1935
24 Ga0068858_100000009 3300005842 Bacteria 237748
25 Ga0068858_100215197 3300005842 Bacteria 1819
26 Ga0068860_100318336 3300005843 Unclassified 1527
27 Ga0068862_100001603 3300005844 Bacteria 20605
28 Ga0081455_10005473 3300005937 Bacteria 13921
29 Ga0070717_10014557 3300006028 Bacteria 6055
30 Ga0070717_10042665 3300006028 Bacteria 3700
31 Ga0070716_100313028 3300006173 Bacteria 1097
32 Ga0105245_10000012 3300009098 Bacteria 267151
33 Ga0105245_10000020 3300009098 Bacteria 181774
34 Ga0105245_10000179 3300009098 Bacteria 60347
35 Ga0105245_10268136 3300009098 Bacteria 1664
36 Ga0105247_10000185 3300009101 Bacteria 60656
37 Ga0105242_10001335 3300009176 Bacteria 19502
38 Ga0105242_10139162 3300009176 Unclassified 2104
39 Ga0105248_10000126 3300009177 Bacteria 88461
40 Ga0105238_10000126 3300009551 Bacteria 83957
41 Ga0105249_10000080 3300009553 Bacteria 138080
42 Ga0105249_10020910 3300009553 Bacteria 5852
43 Ga0105239_10692472 3300010375 Bacteria 1165
44 Ga0157370_10852931 3300013104 Unclassified 828
45 Ga0157369_10000135 3300013105 Bacteria 105364
46 Ga0157374_10007323 3300013296 Bacteria 9408
47 Ga0157378_10512449 3300013297 Bacteria 1200
48 Ga0157379_10005944 3300014968 Bacteria 10511
49 Ga0157379_10006880 3300014968 Bacteria 9832
50 Ga0206356_11761885 3300020070 Bacteria 1100
51 Ga0207682_10000176 3300025893 Bacteria 29031
52 Ga0207710_10000180 3300025900 Bacteria 63999
53 Ga0207707_10035541 3300025912 Bacteria 4357
54 Ga0207652_10000323 3300025921 Bacteria 49536
55 Ga0207694_10000004 3300025924 Bacteria 967075
56 Ga0207659_10000014 3300025926 Bacteria 168481
57 Ga0207687_10000011 3300025927 Bacteria 388349
58 Ga0207687_10000013 3300025927 Bacteria 299826
59 Ga0207687_10001076 3300025927 Bacteria 18525
60 Ga0207664_10106826 3300025929 Bacteria 2322
61 Ga0207686_10001163 3300025934 Bacteria 15181
62 Ga0207686_10297790 3300025934 Unclassified 1197
63 Ga0207711_10000024 3300025941 Bacteria 293596
64 Ga0207712_10000007 3300025961 Bacteria 539589
65 Ga0207668_10073083 3300025972 Bacteria 2456
66 Ga0207677_10000750 3300026023 Bacteria 18704
67 Ga0207703_10000207 3300026035 Bacteria 68866
68 Ga0207703_10179847 3300026035 Bacteria 1866
69 Ga0207639_10000536 3300026041 Bacteria 26077
70 Ga0207702_10048826 3300026078 Archaea 3570
71 Ga0207698_10313438 3300026142 Bacteria 1466
72 Ga0268266_10000047 3300028379 Bacteria 310996
73 Ga0265322_10061728 3300028654 Unclassified 1063
74 Ga0265327_10031036 3300031251 Bacteria 3009
75 Ga0373954_0022518 3300035118 Bacteria 2859
76 Ga0373933_0039995 3300035724 Bacteria 2760
77 Ga0373933_0045774 3300035724 Bacteria 2596
78 Ga0373947_0648055 3300035725 Bacteria 720
79 Ga0373937_0182057 3300036401 Bacteria 1973
80 Ga0373937_0614403 3300036401 Bacteria 1032
81 Ga0451807_2129689 3300041486 Bacteria 1051
82 Ga0451839_1081320 3300041496 Bacteria 696
83 Ga0451853_0959972 3300041512 Bacteria 5027
84 Ga0466963_0000105 3300044694 Bacteria 30285
85 Ga0466963_0209371 3300044694 Bacteria 1364
86 Ga0466957_0000177 3300044842 Bacteria 28545
87 Ga0466967_0381740 3300045976 Bacteria 1368
88 Ga0495592_0251079 3300046454 Bacteria 1169
89 Ga0495629_0008196 3300046459 Bacteria 7685
90 Ga0495629_0049228 3300046459 Bacteria 2954
91 Ga0495629_0369446 3300046459 Bacteria 977
92 Ga0495641_0000029 3300046461 Bacteria 97259
93 Ga0495641_0038515 3300046461 Bacteria 2233
94 Ga0495608_0170306 3300046511 Bacteria 1381
95 Ga0495620_0001094 3300046515 Bacteria 16561
96 Ga0495628_0172715 3300046516 Bacteria 1638
97 Ga0495628_0779352 3300046516 Bacteria 670
98 Ga0495630_0000714 3300046517 Bacteria 23478
99 Ga0495652_0604025 3300046529 Bacteria 748
100 Ga0495665_0290045 3300046531 Unclassified 839
101 Ga0495587_0146612 3300046536 Bacteria 1346
102 Ga0495645_0028882 3300046543 Unclassified 4031
103 Ga0495645_0054395 3300046543 Unclassified 2908
104 Ga0495634_0038811 3300046642 Bacteria 3245
105 Ga0495635_0108864 3300046663 Bacteria 1893
106 Ga0495657_0005566 3300046675 Bacteria 9943
107 Ga0495657_0030285 3300046675 Bacteria 3792
108 Ga0495599_0004060 3300046678 Bacteria 8622
109 Ga0495646_0315113 3300046680 Bacteria 825
110 Ga0495647_0337044 3300046681 Unclassified 685
111 Ga0495658_0245481 3300046683 Bacteria 1125
112 Ga0495669_0000030 3300046684 Bacteria 102988
113 Ga0495613_0190534 3300046689 Bacteria 1449
114 Ga0495624_0000060 3300046690 Bacteria 69512
115 Ga0495649_0001186 3300046694 Bacteria 20132
116 Ga0495604_0300401 3300047317 Bacteria 1078
117 Ga0495676_0000873 3300047321 Bacteria 25176
118 Ga0495676_0062599 3300047321 Bacteria 2904
119 Ga0495679_021643 3300047446 Unclassified 2215
120 Ga0495684_0673609 3300047471 Bacteria 689
121 Ga0495593_0113564 3300047673 Unclassified 1382
122 Ga0495602_0010203 3300048088 Bacteria 9748
123 Ga0496100_0000010 3300048903 Bacteria 205204
124 Ga0496100_0854405 3300048903 Unclassified 714
125 Ga0496101_0000025 3300048904 Bacteria 205204
126 Ga0496103_0320509 3300048906 Unclassified 997
127 Ga0496104_0000009 3300048907 Bacteria 488055
128 Ga0496105_0000007 3300048908 Bacteria 339658
129 Ga0496105_0215346 3300048908 Bacteria 1565
130 Ga0496106_0000012 3300048909 Bacteria 205158
131 Ga0496107_0000010 3300048910 Bacteria 205188
132 Ga0496108_0000001 3300048911 Bacteria 919044
133 Ga0496108_0354215 3300048911 Bacteria 1281
134 Ga0496109_0000004 3300048912 Bacteria 404818
135 Ga0496110_0051869 3300048913 Bacteria 3605
136 Ga0496111_0009743 3300048914 Bacteria 6421
137 Ga0496112_0191958 3300048915 Bacteria 2004
138 Ga0496112_0279967 3300048915 Unclassified 1615
139 Ga0496113_0259115 3300048916 Bacteria 1389
140 Ga0496113_0422866 3300048916 Bacteria 1070
141 Ga0496114_0003890 3300048917 Bacteria 11513
142 Ga0496121_0033761 3300048924 Bacteria 4623
143 Ga0496125_0123137 3300048928 Bacteria 1844
144 Ga0501036_0155866 3300049572 Bacteria 1926
145 Ga0501040_0064024 3300049576 Bacteria 2531
146 Ga0501042_0080044 3300049578 Bacteria 2341
147 Ga0501068_0245931 3300049584 Bacteria 1139
148 Ga0501072_0598797 3300049588 Bacteria 869
149 Ga0501075_0445944 3300049591 Bacteria 987
150 Ga0501076_0106904 3300049592 Bacteria 2259
151 Ga0501076_0685381 3300049592 Unclassified 846
152 Ga0501079_0118646 3300049741 Bacteria 2057
153 Ga0501080_0391141 3300049742 Bacteria 1252
154 Ga0501081_0830372 3300049743 Bacteria 696
155 Ga0501083_0220210 3300049744 Bacteria 1236
156 Ga0501045_0087142 3300049824 Bacteria 2305
157 Ga0495601_0000066 3300053077 Bacteria 56855
158 Ga0495601_0006750 3300053077 Bacteria 6721
159 Ga0495612_0027047 3300053078 Bacteria 2306
160 Ga0495595_0184184 3300053084 Bacteria 1036
161 Ga0495619_0180019 3300053085 Bacteria 1462
162 Ga0500614_001661 3300053123 Bacteria 5212
163 Ga0501084_0058917 3300054114 Bacteria 3214

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028654 Ga0265322_10061728 Ga0265322_100617282 137
2 3300031251 Ga0265327_10031036 Ga0265327_100310363 137
3 3300044694 Ga0466963_0209371 Ga0466963_0209371_104_589 137
4 3300045976 Ga0466967_0381740 Ga0466967_0381740_904_1356 137
5 3300005333 Ga0070677_10000276 Ga0070677_100002767 138
6 3300005337 Ga0070682_100000017 Ga0070682_100000017149 138
7 3300005367 Ga0070667_100001841 Ga0070667_1000018412 138
8 3300005435 Ga0070714_100021793 Ga0070714_1000217934 138
9 3300005436 Ga0070713_100076481 Ga0070713_1000764812 138
10 3300005842 Ga0068858_100215197 Ga0068858_1002151971 138
11 3300005843 Ga0068860_100318336 Ga0068860_1003183362 138
12 3300005844 Ga0068862_100001603 Ga0068862_1000016039 138
13 3300005937 Ga0081455_10005473 Ga0081455_1000547312 138
14 3300006028 Ga0070717_10014557 Ga0070717_100145572 138
15 3300009098 Ga0105245_10000020 Ga0105245_10000020122 138
16 3300009553 Ga0105249_10000080 Ga0105249_10000080100 138
17 3300009553 Ga0105249_10020910 Ga0105249_100209103 138
18 3300014968 Ga0157379_10005944 Ga0157379_100059447 138
19 3300014968 Ga0157379_10006880 Ga0157379_100068808 138
20 3300025893 Ga0207682_10000176 Ga0207682_1000017623 138
21 3300025927 Ga0207687_10000013 Ga0207687_10000013164 138
22 3300025929 Ga0207664_10106826 Ga0207664_101068262 138
23 3300025961 Ga0207712_10000007 Ga0207712_10000007493 138
24 3300026035 Ga0207703_10179847 Ga0207703_101798473 138
25 3300036401 Ga0373937_0614403 Ga0373937_0614403_263_712 138
26 3300046459 Ga0495629_0369446 Ga0495629_0369446_403_852 138
27 3300046515 Ga0495620_0001094 Ga0495620_0001094_15332_15787 138
28 3300046516 Ga0495628_0779352 Ga0495628_0779352_208_657 138
29 3300046517 Ga0495630_0000714 Ga0495630_0000714_20590_21039 138
30 3300046529 Ga0495652_0604025 Ga0495652_0604025_251_700 138
31 3300046536 Ga0495587_0146612 Ga0495587_0146612_165_614 138
32 3300046663 Ga0495635_0108864 Ga0495635_0108864_742_1191 138
33 3300046675 Ga0495657_0030285 Ga0495657_0030285_1067_1516 138
34 3300046680 Ga0495646_0315113 Ga0495646_0315113_27_476 138
35 3300046684 Ga0495669_0000030 Ga0495669_0000030_87048_87503 138
36 3300047321 Ga0495676_0000873 Ga0495676_0000873_23829_24284 138
37 3300047471 Ga0495684_0673609 Ga0495684_0673609_94_543 138
38 3300048903 Ga0496100_0000010 Ga0496100_0000010_177202_177657 138
39 3300048904 Ga0496101_0000025 Ga0496101_0000025_177202_177657 138
40 3300048907 Ga0496104_0000009 Ga0496104_0000009_350897_351352 138
41 3300048908 Ga0496105_0000007 Ga0496105_0000007_136704_137159 138
42 3300048909 Ga0496106_0000012 Ga0496106_0000012_27520_27975 138
43 3300048910 Ga0496107_0000010 Ga0496107_0000010_27532_27987 138
44 3300053077 Ga0495601_0006750 Ga0495601_0006750_3624_4073 138
45 3300053084 Ga0495595_0184184 Ga0495595_0184184_257_712 138
46 3300053085 Ga0495619_0180019 Ga0495619_0180019_413_862 138
47 3300005436 Ga0070713_100147417 Ga0070713_1001474172 139
48 3300006028 Ga0070717_10042665 Ga0070717_100426652 139
49 3300006173 Ga0070716_100313028 Ga0070716_1003130282 139
50 3300035118 Ga0373954_0022518 Ga0373954_0022518_2038_2505 139
51 3300035724 Ga0373933_0039995 Ga0373933_0039995_1258_1725 139
52 3300046531 Ga0495665_0290045 Ga0495665_0290045_44_511 139
53 3300046543 Ga0495645_0028882 Ga0495645_0028882_500_958 139
54 3300046642 Ga0495634_0038811 Ga0495634_0038811_2054_2521 139
55 3300046675 Ga0495657_0005566 Ga0495657_0005566_529_996 139
56 3300046689 Ga0495613_0190534 Ga0495613_0190534_517_984 139
57 3300047317 Ga0495604_0300401 Ga0495604_0300401_303_770 139
58 3300048088 Ga0495602_0010203 Ga0495602_0010203_444_911 139
59 3300049572 Ga0501036_0155866 Ga0501036_0155866_1212_1670 139
60 3300049576 Ga0501040_0064024 Ga0501040_0064024_1266_1724 139
61 3300049578 Ga0501042_0080044 Ga0501042_0080044_527_985 139
62 3300049584 Ga0501068_0245931 Ga0501068_0245931_603_1064 139
63 3300049591 Ga0501075_0445944 Ga0501075_0445944_249_707 139
64 3300049592 Ga0501076_0106904 Ga0501076_0106904_157_615 139
65 3300049741 Ga0501079_0118646 Ga0501079_0118646_302_760 139
66 3300049742 Ga0501080_0391141 Ga0501080_0391141_374_832 139
67 3300049743 Ga0501081_0830372 Ga0501081_0830372_218_676 139
68 3300049824 Ga0501045_0087142 Ga0501045_0087142_580_1038 139
69 3300053077 Ga0495601_0000066 Ga0495601_0000066_22715_23134 139
70 3300054114 Ga0501084_0058917 Ga0501084_0058917_2714_3172 139
71 3300001979 JGI24740J21852_10002007 JGI24740J21852_1000200713 140
72 3300005329 Ga0070683_100071562 Ga0070683_1000715624 140
73 3300005337 Ga0070682_100364841 Ga0070682_1003648412 140
74 3300005347 Ga0070668_100088271 Ga0070668_1000882714 140
75 3300005354 Ga0070675_100000008 Ga0070675_100000008213 140
76 3300005365 Ga0070688_100001412 Ga0070688_1000014129 140
77 3300005458 Ga0070681_10028122 Ga0070681_100281223 140
78 3300005466 Ga0070685_10001592 Ga0070685_100015929 140
79 3300005530 Ga0070679_100000247 Ga0070679_10000024725 140
80 3300005539 Ga0068853_100000161 Ga0068853_10000016119 140
81 3300005544 Ga0070686_100150316 Ga0070686_1001503163 140
82 3300005548 Ga0070665_100000138 Ga0070665_10000013893 140
83 3300005548 Ga0070665_100406947 Ga0070665_1004069472 140
84 3300005577 Ga0068857_100306230 Ga0068857_1003062302 140
85 3300005614 Ga0068856_100005497 Ga0068856_10000549711 140
86 3300005614 Ga0068856_100071187 Ga0068856_1000711873 140
87 3300005616 Ga0068852_100190428 Ga0068852_1001904284 140
88 3300005842 Ga0068858_100000009 Ga0068858_10000000963 140
89 3300009098 Ga0105245_10000012 Ga0105245_1000001254 140
90 3300009098 Ga0105245_10000179 Ga0105245_1000017918 140
91 3300009098 Ga0105245_10268136 Ga0105245_102681362 140
92 3300009101 Ga0105247_10000185 Ga0105247_1000018545 140
93 3300009176 Ga0105242_10001335 Ga0105242_1000133519 140
94 3300009176 Ga0105242_10139162 Ga0105242_101391621 140
95 3300009177 Ga0105248_10000126 Ga0105248_1000012657 140
96 3300009551 Ga0105238_10000126 Ga0105238_1000012669 140
97 3300010375 Ga0105239_10692472 Ga0105239_106924722 140
98 3300013104 Ga0157370_10852931 Ga0157370_108529312 140
99 3300013105 Ga0157369_10000135 Ga0157369_1000013585 140
100 3300013296 Ga0157374_10007323 Ga0157374_100073235 140
101 3300013297 Ga0157378_10512449 Ga0157378_105124493 140
102 3300020070 Ga0206356_11761885 Ga0206356_117618853 140
103 3300025900 Ga0207710_10000180 Ga0207710_1000018032 140
104 3300025912 Ga0207707_10035541 Ga0207707_100355414 140
105 3300025921 Ga0207652_10000323 Ga0207652_1000032331 140
106 3300025924 Ga0207694_10000004 Ga0207694_10000004361 140
107 3300025926 Ga0207659_10000014 Ga0207659_10000014101 140
108 3300025927 Ga0207687_10000011 Ga0207687_10000011107 140
109 3300025927 Ga0207687_10001076 Ga0207687_1000107611 140
110 3300025934 Ga0207686_10001163 Ga0207686_100011635 140
111 3300025934 Ga0207686_10297790 Ga0207686_102977901 140
112 3300025941 Ga0207711_10000024 Ga0207711_10000024169 140
113 3300025972 Ga0207668_10073083 Ga0207668_100730832 140
114 3300026023 Ga0207677_10000750 Ga0207677_1000075014 140
115 3300026035 Ga0207703_10000207 Ga0207703_100002079 140
116 3300026041 Ga0207639_10000536 Ga0207639_1000053621 140
117 3300026078 Ga0207702_10048826 Ga0207702_1004882610 140
118 3300026142 Ga0207698_10313438 Ga0207698_103134382 140
119 3300028379 Ga0268266_10000047 Ga0268266_1000004763 140
120 3300035724 Ga0373933_0045774 Ga0373933_0045774_421_882 140
121 3300035725 Ga0373947_0648055 Ga0373947_0648055_73_555 140
122 3300036401 Ga0373937_0182057 Ga0373937_0182057_645_1106 140
123 3300041486 Ga0451807_2129689 Ga0451807_2129689_485_949 140
124 3300041496 Ga0451839_1081320 Ga0451839_1081320_159_647 140
125 3300041512 Ga0451853_0959972 Ga0451853_0959972_3322_3786 140
126 3300044694 Ga0466963_0000105 Ga0466963_0000105_1281_1775 140
127 3300044842 Ga0466957_0000177 Ga0466957_0000177_14851_15315 140
128 3300046454 Ga0495592_0251079 Ga0495592_0251079_527_997 140
129 3300046459 Ga0495629_0008196 Ga0495629_0008196_2536_3003 140
130 3300046459 Ga0495629_0049228 Ga0495629_0049228_1014_1502 140
131 3300046461 Ga0495641_0000029 Ga0495641_0000029_37593_38057 140
132 3300046461 Ga0495641_0038515 Ga0495641_0038515_324_788 140
133 3300046511 Ga0495608_0170306 Ga0495608_0170306_454_918 140
134 3300046516 Ga0495628_0172715 Ga0495628_0172715_284_748 140
135 3300046543 Ga0495645_0054395 Ga0495645_0054395_1435_1914 140
136 3300046678 Ga0495599_0004060 Ga0495599_0004060_1116_1580 140
137 3300046681 Ga0495647_0337044 Ga0495647_0337044_19_483 140
138 3300046683 Ga0495658_0245481 Ga0495658_0245481_281_763 140
139 3300046690 Ga0495624_0000060 Ga0495624_0000060_33131_33595 140
140 3300046694 Ga0495649_0001186 Ga0495649_0001186_140_583 140
141 3300047321 Ga0495676_0062599 Ga0495676_0062599_204_686 140
142 3300047446 Ga0495679_021643 Ga0495679_021643_1130_1594 140
143 3300047673 Ga0495593_0113564 Ga0495593_0113564_561_1028 140
144 3300048903 Ga0496100_0854405 Ga0496100_0854405_131_598 140
145 3300048906 Ga0496103_0320509 Ga0496103_0320509_289_756 140
146 3300048908 Ga0496105_0215346 Ga0496105_0215346_179_646 140
147 3300048911 Ga0496108_0000001 Ga0496108_0000001_788284_788760 140
148 3300048911 Ga0496108_0354215 Ga0496108_0354215_91_558 140
149 3300048912 Ga0496109_0000004 Ga0496109_0000004_42095_42571 140
150 3300048913 Ga0496110_0051869 Ga0496110_0051869_2500_2964 140
151 3300048914 Ga0496111_0009743 Ga0496111_0009743_4714_5181 140
152 3300048915 Ga0496112_0191958 Ga0496112_0191958_905_1372 140
153 3300048915 Ga0496112_0279967 Ga0496112_0279967_144_608 140
154 3300048916 Ga0496113_0259115 Ga0496113_0259115_437_904 140
155 3300048916 Ga0496113_0422866 Ga0496113_0422866_10_474 140
156 3300048917 Ga0496114_0003890 Ga0496114_0003890_9387_9857 140
157 3300048924 Ga0496121_0033761 Ga0496121_0033761_1227_1712 140
158 3300048928 Ga0496125_0123137 Ga0496125_0123137_687_1163 140
159 3300049588 Ga0501072_0598797 Ga0501072_0598797_122_619 140
160 3300049592 Ga0501076_0685381 Ga0501076_0685381_277_747 140
161 3300049744 Ga0501083_0220210 Ga0501083_0220210_552_1043 140
162 3300053078 Ga0495612_0027047 Ga0495612_0027047_22_486 140
163 3300053123 Ga0500614_001661 Ga0500614_001661_2318_2782 140

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.7867 2 136
6y3l-assembly1.cif.gz_A nmr solution structure of the hazelnut allergen cor a 1.0404 0.7556 1 128
3kay-assembly1.cif.gz_A crystal structure of abscisic acid receptor pyl1 0.7534 2 135
5ygv-assembly1.cif.gz_A crystal structure of the abscisic acid receptor pyr1 in complex with an antagonist 0.7534 2 135
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.7524 2 135
ID Description Score Start End Superfamily
af_P9WJ05_1_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7913 1 134 3.30.530.20
af_Q94K52_78_219_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.786 1 140 3.30.530.20
af_P9WLU7_2_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7785 1 135 3.30.530.20
2d4rA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7743 2 136 3.30.530.20
af_Q8MLL3_83_228_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7535 2 138 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A3L7V0F2-F1-model_v4 CDP-paratose 2-epimerase 0.9774 3 133
AF-A0A7V9IHD2-F1-model_v4 SRPBCC family protein 0.9762 1 139
AF-A0A7V4AQR6-F1-model_v4 CDP-paratose 2-epimerase 0.974 1 139
AF-A0A4P5XQB4-F1-model_v4 deleted 0.9719 2 135
AF-A0A7C6DZ04-F1-model_v4 CDP-paratose 2-epimerase 0.9713 2 135

Feature Viewer

pLDDT pTM Quality
89.1 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map