F240289

General Info

Members Datasets Scaffolds Average Seq Length
162 89 324 138

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0090597|Ga0501047_0090597_1639_2079
Length 146
Sequence MKGRREVTSGSAGAVELIGEALARAAAERPAVGGFPQFADSLRRAGIRRNRWYVPAALALYETEAGPAVMQGASLIDGAAPIGDFDPQALVVAIRADQAGESTFPEFLAAIWAAGVFEYEVDFTARSCTYFGADRGERYVERYPAA

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
70 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
71 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
72 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
73 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
74 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
75 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
78 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
81 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
84 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
85 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 1.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.32
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 30.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0090597 3300049581 Bacteria 2935
2 SwRhRL2b_contig_1886366 2162886007 Bacteria 82303
3 Ga0065704_10070139 3300005289 Bacteria 529843
4 Ga0068868_100831304 3300005338 Unclassified 835
5 Ga0070661_101326111 3300005344 Unclassified 604
6 Ga0070671_100220722 3300005355 Bacteria 1608
7 Ga0070714_100027413 3300005435 Bacteria 4718
8 Ga0070713_100018985 3300005436 Bacteria 5236
9 Ga0070713_100266454 3300005436 Unclassified 1567
10 Ga0070713_100574890 3300005436 Bacteria 1069
11 Ga0070711_100029415 3300005439 Bacteria 3625
12 Ga0070663_100097462 3300005455 Unclassified 2189
13 Ga0070681_10029062 3300005458 Bacteria 5550
14 Ga0070681_10117321 3300005458 Bacteria 2598
15 Ga0070681_10643508 3300005458 Bacteria 975
16 Ga0070679_100370849 3300005530 Bacteria 1378
17 Ga0070684_100067651 3300005535 Bacteria 3139
18 Ga0070684_100077799 3300005535 Bacteria 2930
19 Ga0068853_100490988 3300005539 Bacteria 1158
20 Ga0068853_100862166 3300005539 Unclassified 869
21 Ga0070665_100064310 3300005548 Bacteria 3679
22 Ga0068855_100006612 3300005563 Bacteria 14083
23 Ga0068855_100010911 3300005563 Bacteria 10968
24 Ga0068855_100018223 3300005563 Bacteria 8434
25 Ga0068855_100117140 3300005563 Bacteria 3052
26 Ga0068855_100665093 3300005563 Unclassified 1117
27 Ga0068855_101649831 3300005563 Bacteria 655
28 Ga0068857_100451106 3300005577 Bacteria 1202
29 Ga0068854_100591707 3300005578 Bacteria 946
30 Ga0068854_101108222 3300005578 Unclassified 705
31 Ga0068856_100135307 3300005614 Bacteria 2470
32 Ga0068856_100322293 3300005614 Unclassified 1563
33 Ga0068856_100354225 3300005614 Bacteria 1486
34 Ga0068856_101937646 3300005614 Unclassified 600
35 Ga0068852_100000150 3300005616 Bacteria 46731
36 Ga0068852_100190742 3300005616 Bacteria 1934
37 Ga0081540_1068393 3300005983 Bacteria 1655
38 Ga0070717_10655234 3300006028 Unclassified 953
39 Ga0070712_100530618 3300006175 Bacteria 990
40 Ga0105240_10118591 3300009093 Bacteria 3189
41 Ga0105240_10189999 3300009093 Bacteria 2416
42 Ga0105240_10284134 3300009093 Unclassified 1900
43 Ga0105240_10870092 3300009093 Unclassified 971
44 Ga0105241_10303089 3300009174 Bacteria 1372
45 Ga0105241_11302159 3300009174 Unclassified 692
46 Ga0105248_10004914 3300009177 Bacteria 14767
47 Ga0105237_10000045 3300009545 Bacteria 171156
48 Ga0105237_10010221 3300009545 Bacteria 9999
49 Ga0105237_10285712 3300009545 Unclassified 1652
50 Ga0105237_11996202 3300009545 Bacteria 589
51 Ga0105238_10240240 3300009551 Unclassified 1789
52 Ga0105238_10647997 3300009551 Bacteria 1066
53 Ga0105238_10666272 3300009551 Bacteria 1051
54 Ga0105239_10935798 3300010375 Bacteria 995
55 Ga0157371_11192914 3300013102 Unclassified 586
56 Ga0157370_10090174 3300013104 Bacteria 2879
57 Ga0157370_10100539 3300013104 Bacteria 2709
58 Ga0157370_10114798 3300013104 Bacteria 2516
59 Ga0157370_10280399 3300013104 Bacteria 1540
60 Ga0157370_11107932 3300013104 Bacteria 715
61 Ga0157369_10183753 3300013105 Bacteria 2199
62 Ga0157369_10356517 3300013105 Unclassified 1519
63 Ga0157369_10995401 3300013105 Unclassified 858
64 Ga0163162_10495899 3300013306 Bacteria 1352
65 Ga0157372_10013861 3300013307 Bacteria 8609
66 Ga0157372_10021553 3300013307 Bacteria 6962
67 Ga0157372_10034364 3300013307 Bacteria 5573
68 Ga0157372_10314793 3300013307 Viruses 1822
69 Ga0157372_10421265 3300013307 Unclassified 1556
70 Ga0157372_11313262 3300013307 Unclassified 835
71 Ga0157375_10498788 3300013308 Bacteria 1381
72 Ga0157376_10599829 3300014969 Unclassified 1096
73 Ga0213876_10357691 3300021384 Bacteria 777
74 Ga0213875_10005691 3300021388 Bacteria 6644
75 Ga0213875_10044040 3300021388 Unclassified 2096
76 Ga0213875_10124505 3300021388 Unclassified 1205
77 Ga0213875_10314423 3300021388 Unclassified 742
78 Ga0207692_10298978 3300025898 Bacteria 979
79 Ga0207707_10714686 3300025912 Unclassified 840
80 Ga0207695_10000070 3300025913 Bacteria 318111
81 Ga0207695_10077898 3300025913 Unclassified 3365
82 Ga0207695_10321897 3300025913 Bacteria 1436
83 Ga0207695_10550198 3300025913 Unclassified 1036
84 Ga0207695_10556329 3300025913 Unclassified 1029
85 Ga0207671_10000217 3300025914 Bacteria 86111
86 Ga0207671_10012182 3300025914 Bacteria 6936
87 Ga0207671_10397611 3300025914 Unclassified 1096
88 Ga0207663_10020888 3300025916 Plasmid 3717
89 Ga0207663_11207890 3300025916 Unclassified 609
90 Ga0207660_10056731 3300025917 Bacteria 2803
91 Ga0207657_10422123 3300025919 Unclassified 1048
92 Ga0207652_10328435 3300025921 Bacteria 1381
93 Ga0207694_10511323 3300025924 Bacteria 1006
94 Ga0207694_10597077 3300025924 Bacteria 928
95 Ga0207700_10012331 3300025928 Bacteria 5505
96 Ga0207700_10207050 3300025928 Unclassified 1656
97 Ga0207700_10278998 3300025928 Bacteria 1437
98 Ga0207664_10017606 3300025929 Bacteria 5243
99 Ga0207711_10003149 3300025941 Bacteria 14383
100 Ga0207661_10280849 3300025944 Unclassified 1488
101 Ga0207661_10891936 3300025944 Unclassified 819
102 Ga0207667_10001248 3300025949 Bacteria 31895
103 Ga0207667_10006578 3300025949 Bacteria 14062
104 Ga0207667_10088864 3300025949 Bacteria 3194
105 Ga0207667_10731358 3300025949 Unclassified 990
106 Ga0207667_11835901 3300025949 Unclassified 569
107 Ga0207640_10176323 3300025981 Bacteria 1598
108 Ga0207640_10768399 3300025981 Unclassified 832
109 Ga0207640_11266873 3300025981 Unclassified 657
110 Ga0207639_11089430 3300026041 Bacteria 749
111 Ga0207639_11225348 3300026041 Unclassified 704
112 Ga0207678_10010244 3300026067 Bacteria 8229
113 Ga0207678_10083240 3300026067 Bacteria 2736
114 Ga0207678_10254178 3300026067 Bacteria 1505
115 Ga0207702_10113571 3300026078 Bacteria 2412
116 Ga0207702_11003738 3300026078 Bacteria 828
117 Ga0207702_11979518 3300026078 Unclassified 573
118 Ga0207674_10483132 3300026116 Bacteria 1197
119 Ga0207698_10000133 3300026142 Bacteria 46729
120 Ga0207698_11484233 3300026142 Bacteria 693
121 Ga0268266_10054701 3300028379 Bacteria 3430
122 Ga0268266_11358175 3300028379 Bacteria 686
123 Ga0265338_10063176 3300028800 Bacteria 3230
124 Ga0265338_10902336 3300028800 Unclassified 602
125 Ga0265762_1030866 3300030760 Unclassified 1018
126 Ga0265760_10044194 3300031090 Unclassified 1333
127 Ga0265339_10058290 3300031249 Bacteria 2085
128 Ga0265314_10000919 3300031711 Bacteria 34671
129 Ga0265314_10189463 3300031711 Unclassified 1225
130 Ga0265342_10057293 3300031712 Bacteria 2307
131 Ga0395898_0500532 3300037466 Bacteria 1156
132 Ga0436364_0074109 3300037853 Unclassified 980
133 Ga0436364_0492056 3300037853 Unclassified 1468
134 Ga0436364_1398570 3300037853 Bacteria 9749
135 Ga0436365_1118922 3300039437 Bacteria 896
136 Ga0451804_1104116 3300041463 Unclassified 652
137 Ga0495582_0430714 3300046473 Unclassified 761
138 Ga0495662_0285778 3300046476 Unclassified 812
139 Ga0495628_0049053 3300046516 Bacteria 3344
140 Ga0495640_0298902 3300046533 Bacteria 1000
141 Ga0495645_0505657 3300046543 Bacteria 755
142 Ga0495645_0817621 3300046543 Unclassified 558
143 Ga0495634_0211087 3300046642 Bacteria 1202
144 Ga0495657_0058570 3300046675 Bacteria 2558
145 Ga0495646_0156554 3300046680 Bacteria 1264
146 Ga0495649_0200576 3300046694 Bacteria 1036
147 Ga0495674_0049645 3300047319 Bacteria 3706
148 Ga0495674_0152268 3300047319 Bacteria 1939
149 Ga0495674_0245652 3300047319 Bacteria 1474
150 Ga0495672_0110286 3300047320 Bacteria 1478
151 Ga0496103_0146204 3300048906 Bacteria 1513
152 Ga0496104_0028856 3300048907 Bacteria 5144
153 Ga0496107_0027781 3300048910 Bacteria 4020
154 Ga0496114_0086172 3300048917 Bacteria 2661
155 Ga0496115_0253605 3300048918 Bacteria 1448
156 Ga0496115_0434942 3300048918 Bacteria 1061
157 Ga0496126_0004194 3300048929 Bacteria 17370
158 Ga0496126_0548354 3300048929 Bacteria 918
159 Ga0501034_0314485 3300049571 Bacteria 1500
160 Ga0501083_0097332 3300049744 Bacteria 1941
161 Ga0501044_0154707 3300049823 Bacteria 2273
162 Ga0501044_0787832 3300049823 Bacteria 831
163 Ga0501047_0090597
164 SwRhRL2b_contig_1886366
165 Ga0065704_10070139
166 Ga0068868_100831304
167 Ga0070661_101326111
168 Ga0070671_100220722
169 Ga0070714_100027413
170 Ga0070713_100018985
171 Ga0070713_100266454
172 Ga0070713_100574890
173 Ga0070711_100029415
174 Ga0070663_100097462
175 Ga0070681_10029062
176 Ga0070681_10117321
177 Ga0070681_10643508
178 Ga0070679_100370849
179 Ga0070684_100067651
180 Ga0070684_100077799
181 Ga0068853_100490988
182 Ga0068853_100862166
183 Ga0070665_100064310
184 Ga0068855_100006612
185 Ga0068855_100010911
186 Ga0068855_100018223
187 Ga0068855_100117140
188 Ga0068855_100665093
189 Ga0068855_101649831
190 Ga0068857_100451106
191 Ga0068854_100591707
192 Ga0068854_101108222
193 Ga0068856_100135307
194 Ga0068856_100322293
195 Ga0068856_100354225
196 Ga0068856_101937646
197 Ga0068852_100000150
198 Ga0068852_100190742
199 Ga0081540_1068393
200 Ga0070717_10655234
201 Ga0070712_100530618
202 Ga0105240_10118591
203 Ga0105240_10189999
204 Ga0105240_10284134
205 Ga0105240_10870092
206 Ga0105241_10303089
207 Ga0105241_11302159
208 Ga0105248_10004914
209 Ga0105237_10000045
210 Ga0105237_10010221
211 Ga0105237_10285712
212 Ga0105237_11996202
213 Ga0105238_10240240
214 Ga0105238_10647997
215 Ga0105238_10666272
216 Ga0105239_10935798
217 Ga0157371_11192914
218 Ga0157370_10090174
219 Ga0157370_10100539
220 Ga0157370_10114798
221 Ga0157370_10280399
222 Ga0157370_11107932
223 Ga0157369_10183753
224 Ga0157369_10356517
225 Ga0157369_10995401
226 Ga0163162_10495899
227 Ga0157372_10013861
228 Ga0157372_10021553
229 Ga0157372_10034364
230 Ga0157372_10314793
231 Ga0157372_10421265
232 Ga0157372_11313262
233 Ga0157375_10498788
234 Ga0157376_10599829
235 Ga0213876_10357691
236 Ga0213875_10005691
237 Ga0213875_10044040
238 Ga0213875_10124505
239 Ga0213875_10314423
240 Ga0207692_10298978
241 Ga0207707_10714686
242 Ga0207695_10000070
243 Ga0207695_10077898
244 Ga0207695_10321897
245 Ga0207695_10550198
246 Ga0207695_10556329
247 Ga0207671_10000217
248 Ga0207671_10012182
249 Ga0207671_10397611
250 Ga0207663_10020888
251 Ga0207663_11207890
252 Ga0207660_10056731
253 Ga0207657_10422123
254 Ga0207652_10328435
255 Ga0207694_10511323
256 Ga0207694_10597077
257 Ga0207700_10012331
258 Ga0207700_10207050
259 Ga0207700_10278998
260 Ga0207664_10017606
261 Ga0207711_10003149
262 Ga0207661_10280849
263 Ga0207661_10891936
264 Ga0207667_10001248
265 Ga0207667_10006578
266 Ga0207667_10088864
267 Ga0207667_10731358
268 Ga0207667_11835901
269 Ga0207640_10176323
270 Ga0207640_10768399
271 Ga0207640_11266873
272 Ga0207639_11089430
273 Ga0207639_11225348
274 Ga0207678_10010244
275 Ga0207678_10083240
276 Ga0207678_10254178
277 Ga0207702_10113571
278 Ga0207702_11003738
279 Ga0207702_11979518
280 Ga0207674_10483132
281 Ga0207698_10000133
282 Ga0207698_11484233
283 Ga0268266_10054701
284 Ga0268266_11358175
285 Ga0265338_10063176
286 Ga0265338_10902336
287 Ga0265762_1030866
288 Ga0265760_10044194
289 Ga0265339_10058290
290 Ga0265314_10000919
291 Ga0265314_10189463
292 Ga0265342_10057293
293 Ga0395898_0500532
294 Ga0436364_0074109
295 Ga0436364_0492056
296 Ga0436364_1398570
297 Ga0436365_1118922
298 Ga0451804_1104116
299 Ga0495582_0430714
300 Ga0495662_0285778
301 Ga0495628_0049053
302 Ga0495640_0298902
303 Ga0495645_0505657
304 Ga0495645_0817621
305 Ga0495634_0211087
306 Ga0495657_0058570
307 Ga0495646_0156554
308 Ga0495649_0200576
309 Ga0495674_0049645
310 Ga0495674_0152268
311 Ga0495674_0245652
312 Ga0495672_0110286
313 Ga0496103_0146204
314 Ga0496104_0028856
315 Ga0496107_0027781
316 Ga0496114_0086172
317 Ga0496115_0253605
318 Ga0496115_0434942
319 Ga0496126_0004194
320 Ga0496126_0548354
321 Ga0501034_0314485
322 Ga0501083_0097332
323 Ga0501044_0154707
324 Ga0501044_0787832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07166

DUF1398

Protein of unknown function (DUF1398)

25

142

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mpz-assembly1.cif.gz_A crystal structure of tcp10c domain of drosophila melanogaster sas-4 0.8232 108 131
2hh8-assembly1.cif.gz_A solution nmr structure of the ydfo protein from escherichia coli. northeast structural genomics target er251. 0.749 8 133
5x3s-assembly2.cif.gz_A crystal structure of mouse plk1-pbd in complex with phosphopeptide from hef1 (799-809) 0.7402 108 129
2hh8-assembly1.cif.gz_A solution nmr structure of the ydfo protein from escherichia coli. northeast structural genomics target er251. 0.7334 8 133
3hih-assembly2.cif.gz_B structure of human plk1-pbd with glycerol and sulfate in the phophopeptide binding site 0.7182 108 129
ID Description Score Start End Superfamily
af_P9WLM3_35_151_3.30.1810.10 Alpha Beta;2-Layer Sandwich;YdfO-like fold;YdfO-like 0.9766 16 130 3.30.1810.10
af_P9WLM3_35_151_3.30.1810.10 Alpha Beta;2-Layer Sandwich;YdfO-like fold;YdfO-like 0.9523 16 130 3.30.1810.10
af_Q2G126_2_127_3.30.1810.10 Alpha Beta;2-Layer Sandwich;YdfO-like fold;YdfO-like 0.8686 8 132 3.30.1810.10
af_Q2G126_2_127_3.30.1810.10 Alpha Beta;2-Layer Sandwich;YdfO-like fold;YdfO-like 0.8431 8 132 3.30.1810.10
af_Q5A644_499_658_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.83 108 131 3.20.19.10
ID Description Score Start End GO Terms
AF-A0A1X1T9M9-F1-model_v4 DUF1398 domain-containing protein 0.9913 3 137
AF-A0A0W0YKL6-F1-model_v4 Phage envelope protein 0.9908 1 137
AF-A0A7K1W0Q4-F1-model_v4 DUF1398 domain-containing protein 0.9899 18 137
AF-I4W706-F1-model_v4 Phage envelope protein 0.9895 1 137
AF-A0A7K2FI38-F1-model_v4 DUF1398 domain-containing protein 0.9886 1 137

Map