F239639

General Info

Members Datasets Scaffolds Average Seq Length
162 104 162 248

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10001823|Ga0307516_1000182316
Length 285
Sequence MVFFRFYCILPLGFFVVIWRIPGRAWLSLCIGLAKQVRNMPEGPSIVILKDLVQPFKGEKIVAASGNAKIDMSLLVDQKVTAFRSWGKHFLICLPRTTLRVHFLMFGSYSINEQTKPNPRLRLHLKFSKGDLYFYTCSIKILEGKPDEVYDWSGDVLSDDWDAAAARKKLKAIPETLVADALLDQQIFAGVGNIIKNEVLYRIGVHPESKVGKLPPRKLTQLIKEARNYSFDFLKWKKAFELKKHWLAHTKKTCPRCNIPLIKVAHLGKTQRRAFYCGNCQKLYV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
104 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 0.62
Rhizosphere 90.12
Stem 0
Stem Tuber 0
Unclassified 8.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1761633 2162886007 Bacteria 195701
2 rootH1_10008176 3300003316 Unclassified 2863
3 rootH1_10008176 3300003323 Bacteria 1555
4 rootH1_10118026 3300003316 Bacteria 4874
5 rootH2_10037014 3300003320 Bacteria 6023
6 rootH2_10043346 3300003320 Bacteria 9356
7 rootL2_10245360 3300003322 Unclassified 1476
8 Ga0065704_10000195 3300005289 Bacteria 195830
9 Ga0070690_100451047 3300005330 Bacteria 954
10 Ga0068869_100127577 3300005334 Bacteria 1952
11 Ga0070680_100062550 3300005336 Bacteria 3048
12 Ga0070689_100136089 3300005340 Bacteria 1973
13 Ga0070675_100491786 3300005354 Bacteria 1105
14 Ga0070674_100032031 3300005356 Bacteria 3489
15 Ga0070688_100010468 3300005365 Bacteria 5114
16 Ga0070667_100353849 3300005367 Bacteria 1330
17 Ga0070681_10144318 3300005458 Bacteria 2310
18 Ga0068853_100000246 3300005539 Bacteria 38067
19 Ga0070672_100209021 3300005543 Bacteria 1634
20 Ga0070665_100000014 3300005548 Bacteria 484881
21 Ga0068855_100081072 3300005563 Bacteria 3762
22 Ga0068855_100517756 3300005563 Unclassified 1294
23 Ga0068857_100013793 3300005577 Bacteria 7040
24 Ga0068857_100411965 3300005577 Bacteria 1259
25 Ga0068854_100005010 3300005578 Bacteria 8352
26 Ga0068856_100012225 3300005614 Bacteria 8317
27 Ga0068852_100003524 3300005616 Bacteria 10948
28 Ga0068859_100021415 3300005617 Bacteria 6488
29 Ga0068859_100555052 3300005617 Bacteria 1243
30 Ga0068866_10077554 3300005718 Bacteria 1775
31 Ga0068861_100015930 3300005719 Bacteria 5307
32 Ga0068851_10080304 3300005834 Bacteria 1702
33 Ga0068860_100002976 3300005843 Bacteria 17499
34 Ga0068860_100328340 3300005843 Bacteria 1502
35 Ga0068862_100163410 3300005844 Bacteria 1989
36 Ga0097621_100004699 3300006237 Bacteria 9542
37 Ga0068871_100003742 3300006358 Bacteria 10470
38 Ga0075428_100495706 3300006844 Bacteria 1307
39 Ga0068865_100137612 3300006881 Bacteria 1837
40 Ga0097620_100021416 3300006931 Bacteria 6488
41 Ga0097620_100555040 3300006931 Bacteria 1243
42 Ga0105240_10000190 3300009093 Bacteria 125290
43 Ga0105240_10000226 3300009093 Bacteria 112655
44 Ga0105240_10000674 3300009093 Bacteria 62689
45 Ga0105240_10003458 3300009093 Bacteria 24507
46 Ga0105240_10022996 3300009093 Bacteria 8255
47 Ga0105240_10109242 3300009093 Bacteria 3350
48 Ga0105240_10249061 3300009093 Bacteria 2056
49 Ga0105240_10431364 3300009093 Bacteria 1479
50 Ga0111539_10070610 3300009094 Bacteria 4123
51 Ga0105247_10002604 3300009101 Bacteria 12191
52 Ga0105241_10007361 3300009174 Bacteria 8098
53 Ga0105241_10169670 3300009174 Unclassified 1801
54 Ga0105237_10002384 3300009545 Bacteria 23322
55 Ga0105237_10080740 3300009545 Bacteria 3242
56 Ga0105237_10143986 3300009545 Unclassified 2378
57 Ga0105237_10185898 3300009545 Unclassified 2078
58 Ga0105238_10014554 3300009551 Bacteria 7956
59 Ga0105238_10017064 3300009551 Bacteria 7369
60 Ga0105238_10046260 3300009551 Bacteria 4392
61 Ga0105238_10365989 3300009551 Bacteria 1432
62 Ga0105249_10007609 3300009553 Bacteria 9450
63 Ga0105249_10858855 3300009553 Bacteria 973
64 Ga0105239_10000019 3300010375 Bacteria 273836
65 Ga0105239_10000805 3300010375 Bacteria 44408
66 Ga0105239_10040057 3300010375 Bacteria 5133
67 Ga0105239_10048272 3300010375 Bacteria 4668
68 Ga0105239_10354089 3300010375 Bacteria 1658
69 Ga0157373_10447621 3300013100 Bacteria 929
70 Ga0157370_10026140 3300013104 Bacteria 5767
71 Ga0157369_10009331 3300013105 Bacteria 11220
72 Ga0157374_10223114 3300013296 Bacteria 1850
73 Ga0157374_10334144 3300013296 Bacteria 1503
74 Ga0157378_10115753 3300013297 Bacteria 2464
75 Ga0163162_10045694 3300013306 Bacteria 4387
76 Ga0163162_10050123 3300013306 Bacteria 4187
77 Ga0163162_10257468 3300013306 Bacteria 1877
78 Ga0163162_10482935 3300013306 Bacteria 1370
79 Ga0157372_10001049 3300013307 Bacteria 30209
80 Ga0157372_10003704 3300013307 Bacteria 16417
81 Ga0157372_10073696 3300013307 Bacteria 3849
82 Ga0157372_11034279 3300013307 Unclassified 951
83 Ga0157375_10007833 3300013308 Bacteria 9349
84 Ga0157375_10250455 3300013308 Bacteria 1932
85 Ga0163163_10056586 3300014325 Bacteria 3876
86 Ga0157380_10067783 3300014326 Bacteria 2875
87 Ga0157380_10357802 3300014326 Bacteria 1368
88 Ga0182008_10155537 3300014497 Bacteria 1148
89 Ga0157376_10173056 3300014969 Bacteria 1968
90 Ga0207642_10402911 3300025899 Bacteria 819
91 Ga0207680_10019590 3300025903 Unclassified 3622
92 Ga0207654_10115571 3300025911 Bacteria 1677
93 Ga0207654_10394950 3300025911 Unclassified 960
94 Ga0207695_10000276 3300025913 Bacteria 128924
95 Ga0207695_10000313 3300025913 Bacteria 117072
96 Ga0207695_10001456 3300025913 Bacteria 39626
97 Ga0207695_10020653 3300025913 Bacteria 7539
98 Ga0207695_10033218 3300025913 Bacteria 5633
99 Ga0207695_10091071 3300025913 Bacteria 3064
100 Ga0207671_10001755 3300025914 Bacteria 24384
101 Ga0207671_10003213 3300025914 Bacteria 16446
102 Ga0207671_10037540 3300025914 Bacteria 3592
103 Ga0207671_10181181 3300025914 Unclassified 1639
104 Ga0207681_10030214 3300025923 Bacteria 3530
105 Ga0207694_10010812 3300025924 Bacteria 6891
106 Ga0207694_10037512 3300025924 Bacteria 3723
107 Ga0207650_10059282 3300025925 Bacteria 2853
108 Ga0207669_10257066 3300025937 Bacteria 1304
109 Ga0207691_10139317 3300025940 Bacteria 2138
110 Ga0207679_10454194 3300025945 Bacteria 1137
111 Ga0207667_10000098 3300025949 Bacteria 140051
112 Ga0207667_10079339 3300025949 Bacteria 3403
113 Ga0207712_10005430 3300025961 Bacteria 8044
114 Ga0207712_10027115 3300025961 Bacteria 3823
115 Ga0207640_10005641 3300025981 Bacteria 6823
116 Ga0207658_10157102 3300025986 Bacteria 1860
117 Ga0207639_10043480 3300026041 Bacteria 3373
118 Ga0207639_10351081 3300026041 Bacteria 1317
119 Ga0207708_10087463 3300026075 Bacteria 2399
120 Ga0207674_10015347 3300026116 Bacteria 8417
121 Ga0207674_10125868 3300026116 Bacteria 2528
122 Ga0207674_10176888 3300026116 Bacteria 2086
123 Ga0207674_10193106 3300026116 Bacteria 1986
124 Ga0207675_100066966 3300026118 Bacteria 3357
125 Ga0207698_10046317 3300026142 Bacteria 3283
126 Ga0207428_10201615 3300027907 Bacteria 1497
127 Ga0268266_10000068 3300028379 Bacteria 241100
128 Ga0268265_10222346 3300028380 Bacteria 1653
129 Ga0268264_10005751 3300028381 Bacteria 10513
130 Ga0268264_10231027 3300028381 Bacteria 1708
131 Ga0268264_10635032 3300028381 Bacteria 1055
132 Ga0307517_10011394 3300028786 Bacteria 12321
133 Ga0307515_10000002 3300028794 Bacteria 1231751
134 Ga0307515_10000162 3300028794 Bacteria 163720
135 Ga0307509_10500937 3300031507 Bacteria 899
136 Ga0307516_10001823 3300031730 Bacteria 29270
137 Ga0307516_10063032 3300031730 Bacteria 3590
138 Ga0307516_10209880 3300031730 Bacteria 1662
139 Ga0395905_0156078 3300037471 Bacteria 2146
140 Ga0466972_0018836 3300044658 Bacteria 3450
141 Ga0466964_0015584 3300044706 Unclassified 2894
142 Ga0466968_0013497 3300044735 Bacteria 3212
143 Ga0466957_0029550 3300044842 Bacteria 3269
144 Ga0495638_0149987 3300046460 Bacteria 1353
145 Ga0495611_0000026 3300046648 Bacteria 118428
146 Ga0495649_0020245 3300046694 Bacteria 3733
147 Ga0495672_0002283 3300047320 Bacteria 17804
148 Ga0495686_0000005 3300047472 Bacteria 827143
149 Ga0496104_0753364 3300048907 Unclassified 881
150 Ga0501032_0259625 3300049569 Unclassified 1127
151 Ga0501036_0177375 3300049572 Bacteria 1794
152 Ga0501037_0130895 3300049573 Bacteria 1799
153 Ga0501038_0155695 3300049574 Bacteria 1861
154 Ga0501039_0211064 3300049575 Bacteria 1527
155 Ga0501043_0019263 3300049579 Bacteria 5357
156 Ga0501043_0026934 3300049579 Bacteria 4511
157 Ga0501047_0038688 3300049581 Unclassified 4615
158 Ga0501035_0170052 3300049822 Bacteria 1883
159 Ga0501044_0056946 3300049823 Bacteria 4012
160 Ga0501044_0528989 3300049823 Bacteria 1078
161 Ga0500611_000072 3300053727 Bacteria 41204
162 Ga0500661_011492 3300055283 Bacteria 1601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10008176 rootH1_100081763 217
2 3300003322 rootL2_10245360 rootL2_102453601 217
3 3300025899 Ga0207642_10402911 Ga0207642_104029111 218
4 3300005354 Ga0070675_100491786 Ga0070675_1004917862 222
5 3300049822 Ga0501035_0170052 Ga0501035_0170052_16_693 222
6 3300025940 Ga0207691_10139317 Ga0207691_101393172 223
7 3300009094 Ga0111539_10070610 Ga0111539_100706104 228
8 3300010375 Ga0105239_10000805 Ga0105239_100008059 230
9 3300046648 Ga0495611_0000026 Ga0495611_0000026_56412_57146 234
10 3300005330 Ga0070690_100451047 Ga0070690_1004510471 237
11 3300005340 Ga0070689_100136089 Ga0070689_1001360893 237
12 3300005844 Ga0068862_100163410 Ga0068862_1001634103 237
13 3300006844 Ga0075428_100495706 Ga0075428_1004957061 237
14 3300006881 Ga0068865_100137612 Ga0068865_1001376122 237
15 3300026075 Ga0207708_10087463 Ga0207708_100874633 237
16 3300026116 Ga0207674_10193106 Ga0207674_101931063 237
17 3300027907 Ga0207428_10201615 Ga0207428_102016152 237
18 iso_pu_bacteria 2929239360 2929244775 238
19 3300005367 Ga0070667_100353849 Ga0070667_1003538492 242
20 3300006237 Ga0097621_100004699 Ga0097621_1000046992 242
21 3300006358 Ga0068871_100003742 Ga0068871_1000037426 242
22 3300013297 Ga0157378_10115753 Ga0157378_101157533 242
23 3300013306 Ga0163162_10257468 Ga0163162_102574681 242
24 3300013307 Ga0157372_11034279 Ga0157372_110342791 242
25 3300013308 Ga0157375_10250455 Ga0157375_102504552 242
26 3300014969 Ga0157376_10173056 Ga0157376_101730562 242
27 3300025986 Ga0207658_10157102 Ga0207658_101571022 242
28 3300028794 Ga0307515_10000162 Ga0307515_100001629 242
29 3300055283 Ga0500661_011492 Ga0500661_011492_324_1052 242
30 2162886007 SwRhRL2b_contig_1761633 SwRhRL2b_0391.00006740 243
31 3300003316 rootH1_10118026 rootH1_101180266 243
32 3300003320 rootH2_10037014 rootH2_100370145 243
33 3300003320 rootH2_10043346 rootH2_100433464 243
34 3300005289 Ga0065704_10000195 Ga0065704_10000195148 243
35 3300005334 Ga0068869_100127577 Ga0068869_1001275773 243
36 3300005336 Ga0070680_100062550 Ga0070680_1000625504 243
37 3300005356 Ga0070674_100032031 Ga0070674_1000320313 243
38 3300005365 Ga0070688_100010468 Ga0070688_1000104682 243
39 3300005458 Ga0070681_10144318 Ga0070681_101443183 243
40 3300005539 Ga0068853_100000246 Ga0068853_10000024627 243
41 3300005543 Ga0070672_100209021 Ga0070672_1002090212 243
42 3300005548 Ga0070665_100000014 Ga0070665_100000014281 243
43 3300005563 Ga0068855_100081072 Ga0068855_1000810722 243
44 3300005563 Ga0068855_100517756 Ga0068855_1005177561 243
45 3300005577 Ga0068857_100013793 Ga0068857_1000137936 243
46 3300005577 Ga0068857_100411965 Ga0068857_1004119651 243
47 3300005578 Ga0068854_100005010 Ga0068854_1000050104 243
48 3300005614 Ga0068856_100012225 Ga0068856_1000122258 243
49 3300005616 Ga0068852_100003524 Ga0068852_1000035249 243
50 3300005617 Ga0068859_100021415 Ga0068859_1000214152 243
51 3300005617 Ga0068859_100555052 Ga0068859_1005550522 243
52 3300005718 Ga0068866_10077554 Ga0068866_100775542 243
53 3300005719 Ga0068861_100015930 Ga0068861_1000159306 243
54 3300005834 Ga0068851_10080304 Ga0068851_100803041 243
55 3300005843 Ga0068860_100002976 Ga0068860_1000029767 243
56 3300005843 Ga0068860_100328340 Ga0068860_1003283401 243
57 3300006931 Ga0097620_100021416 Ga0097620_1000214162 243
58 3300006931 Ga0097620_100555040 Ga0097620_1005550401 243
59 3300009093 Ga0105240_10000190 Ga0105240_1000019085 243
60 3300009093 Ga0105240_10000226 Ga0105240_1000022680 243
61 3300009093 Ga0105240_10000674 Ga0105240_1000067424 243
62 3300009093 Ga0105240_10003458 Ga0105240_100034585 243
63 3300009093 Ga0105240_10022996 Ga0105240_100229963 243
64 3300009093 Ga0105240_10109242 Ga0105240_101092423 243
65 3300009093 Ga0105240_10249061 Ga0105240_102490613 243
66 3300009093 Ga0105240_10431364 Ga0105240_104313642 243
67 3300009101 Ga0105247_10002604 Ga0105247_1000260410 243
68 3300009174 Ga0105241_10007361 Ga0105241_100073615 243
69 3300009174 Ga0105241_10169670 Ga0105241_101696702 243
70 3300009545 Ga0105237_10002384 Ga0105237_100023843 243
71 3300009545 Ga0105237_10080740 Ga0105237_100807402 243
72 3300009545 Ga0105237_10143986 Ga0105237_101439863 243
73 3300009545 Ga0105237_10185898 Ga0105237_101858983 243
74 3300009551 Ga0105238_10014554 Ga0105238_100145543 243
75 3300009551 Ga0105238_10017064 Ga0105238_100170643 243
76 3300009551 Ga0105238_10046260 Ga0105238_100462604 243
77 3300009551 Ga0105238_10365989 Ga0105238_103659892 243
78 3300009553 Ga0105249_10007609 Ga0105249_100076093 243
79 3300009553 Ga0105249_10858855 Ga0105249_108588551 243
80 3300010375 Ga0105239_10000019 Ga0105239_10000019127 243
81 3300010375 Ga0105239_10040057 Ga0105239_100400574 243
82 3300010375 Ga0105239_10048272 Ga0105239_100482723 243
83 3300010375 Ga0105239_10354089 Ga0105239_103540892 243
84 3300013100 Ga0157373_10447621 Ga0157373_104476211 243
85 3300013104 Ga0157370_10026140 Ga0157370_100261403 243
86 3300013105 Ga0157369_10009331 Ga0157369_100093313 243
87 3300013296 Ga0157374_10223114 Ga0157374_102231142 243
88 3300013296 Ga0157374_10334144 Ga0157374_103341442 243
89 3300013306 Ga0163162_10045694 Ga0163162_100456942 243
90 3300013306 Ga0163162_10050123 Ga0163162_100501232 243
91 3300013306 Ga0163162_10482935 Ga0163162_104829352 243
92 3300013307 Ga0157372_10001049 Ga0157372_100010495 243
93 3300013307 Ga0157372_10003704 Ga0157372_100037046 243
94 3300013307 Ga0157372_10073696 Ga0157372_100736965 243
95 3300013308 Ga0157375_10007833 Ga0157375_100078338 243
96 3300014325 Ga0163163_10056586 Ga0163163_100565862 243
97 3300014326 Ga0157380_10067783 Ga0157380_100677831 243
98 3300014326 Ga0157380_10357802 Ga0157380_103578022 243
99 3300014497 Ga0182008_10155537 Ga0182008_101555372 243
100 3300025903 Ga0207680_10019590 Ga0207680_100195903 243
101 3300025911 Ga0207654_10115571 Ga0207654_101155713 243
102 3300025911 Ga0207654_10394950 Ga0207654_103949502 243
103 3300025913 Ga0207695_10000276 Ga0207695_1000027617 243
104 3300025913 Ga0207695_10000313 Ga0207695_1000031319 243
105 3300025913 Ga0207695_10001456 Ga0207695_1000145633 243
106 3300025913 Ga0207695_10020653 Ga0207695_100206536 243
107 3300025913 Ga0207695_10033218 Ga0207695_100332183 243
108 3300025913 Ga0207695_10091071 Ga0207695_100910712 243
109 3300025914 Ga0207671_10001755 Ga0207671_100017557 243
110 3300025914 Ga0207671_10003213 Ga0207671_1000321310 243
111 3300025914 Ga0207671_10037540 Ga0207671_100375403 243
112 3300025914 Ga0207671_10181181 Ga0207671_101811813 243
113 3300025923 Ga0207681_10030214 Ga0207681_100302143 243
114 3300025924 Ga0207694_10010812 Ga0207694_100108123 243
115 3300025924 Ga0207694_10037512 Ga0207694_100375123 243
116 3300025925 Ga0207650_10059282 Ga0207650_100592822 243
117 3300025937 Ga0207669_10257066 Ga0207669_102570662 243
118 3300025945 Ga0207679_10454194 Ga0207679_104541942 243
119 3300025949 Ga0207667_10000098 Ga0207667_1000009832 243
120 3300025949 Ga0207667_10079339 Ga0207667_100793393 243
121 3300025961 Ga0207712_10005430 Ga0207712_100054307 243
122 3300025961 Ga0207712_10027115 Ga0207712_100271151 243
123 3300025981 Ga0207640_10005641 Ga0207640_100056413 243
124 3300026041 Ga0207639_10043480 Ga0207639_100434804 243
125 3300026041 Ga0207639_10351081 Ga0207639_103510812 243
126 3300026116 Ga0207674_10015347 Ga0207674_100153473 243
127 3300026116 Ga0207674_10125868 Ga0207674_101258682 243
128 3300026116 Ga0207674_10176888 Ga0207674_101768882 243
129 3300026118 Ga0207675_100066966 Ga0207675_1000669662 243
130 3300026142 Ga0207698_10046317 Ga0207698_100463173 243
131 3300028379 Ga0268266_10000068 Ga0268266_10000068153 243
132 3300028380 Ga0268265_10222346 Ga0268265_102223462 243
133 3300028381 Ga0268264_10005751 Ga0268264_100057517 243
134 3300028381 Ga0268264_10231027 Ga0268264_102310273 243
135 3300028381 Ga0268264_10635032 Ga0268264_106350322 243
136 3300028786 Ga0307517_10011394 Ga0307517_1001139410 243
137 3300028794 Ga0307515_10000002 Ga0307515_1000000277 243
138 3300031507 Ga0307509_10500937 Ga0307509_105009371 243
139 3300031730 Ga0307516_10001823 Ga0307516_1000182316 243
140 3300031730 Ga0307516_10063032 Ga0307516_100630323 243
141 3300031730 Ga0307516_10209880 Ga0307516_102098802 243
142 3300037471 Ga0395905_0156078 Ga0395905_0156078_593_1363 243
143 3300044658 Ga0466972_0018836 Ga0466972_0018836_2653_3393 243
144 3300044706 Ga0466964_0015584 Ga0466964_0015584_1087_1821 243
145 3300044735 Ga0466968_0013497 Ga0466968_0013497_1905_2645 243
146 3300044842 Ga0466957_0029550 Ga0466957_0029550_2258_2989 243
147 3300046460 Ga0495638_0149987 Ga0495638_0149987_123_899 243
148 3300046694 Ga0495649_0020245 Ga0495649_0020245_2891_3628 243
149 3300047320 Ga0495672_0002283 Ga0495672_0002283_16920_17663 243
150 3300047472 Ga0495686_0000005 Ga0495686_0000005_467260_468060 243
151 3300048907 Ga0496104_0753364 Ga0496104_0753364_17_748 243
152 3300049569 Ga0501032_0259625 Ga0501032_0259625_320_1069 243
153 3300049572 Ga0501036_0177375 Ga0501036_0177375_880_1659 243
154 3300049573 Ga0501037_0130895 Ga0501037_0130895_491_1270 243
155 3300049574 Ga0501038_0155695 Ga0501038_0155695_711_1490 243
156 3300049575 Ga0501039_0211064 Ga0501039_0211064_336_1115 243
157 3300049579 Ga0501043_0019263 Ga0501043_0019263_3603_4382 243
158 3300049579 Ga0501043_0026934 Ga0501043_0026934_2740_3480 243
159 3300049581 Ga0501047_0038688 Ga0501047_0038688_822_1601 243
160 3300049823 Ga0501044_0056946 Ga0501044_0056946_2740_3519 243
161 3300049823 Ga0501044_0528989 Ga0501044_0528989_137_877 243
162 3300053727 Ga0500611_000072 Ga0500611_000072_34549_35325 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

153

232

0.87

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

40

138

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z5a-assembly1.cif.gz_A crystal structure of the trapped complex of mouse endonuclease viii-like 3 (mneil3) and hairpin dna with 5'overhang 0.9126 1 240
8b9n-assembly2.cif.gz_C crystal structure of nei domain of mouse neil3 trapped in covalent complex with ssdna with abasic site 0.9098 1 243
8b9n-assembly2.cif.gz_C crystal structure of nei domain of mouse neil3 trapped in covalent complex with ssdna with abasic site 0.9062 1 243
7z5a-assembly1.cif.gz_A crystal structure of the trapped complex of mouse endonuclease viii-like 3 (mneil3) and hairpin dna with 5'overhang 0.8983 1 240
8b9n-assembly1.cif.gz_A crystal structure of nei domain of mouse neil3 trapped in covalent complex with ssdna with abasic site 0.8978 1 243
ID Description Score Start End Superfamily
af_Q8TAT5_147_286_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9575 112 240 1.10.8.50
af_D4ABX3_187_320_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9056 109 243 1.10.8.50
af_D4ABX3_187_320_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8992 109 243 1.10.8.50
1kfvB02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8861 114 235 1.10.8.50
af_P9WNC3_146_285_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8794 114 240 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A4Q5V6F7-F1-model_v4 deleted 0.997 149 243
AF-A0A1C3TRN0-F1-model_v4 DNA glycosylase/AP lyase H2TH DNA-binding domain-containing protein 0.9919 133 242 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0019104
AF-D4T167-F1-model_v4 deleted 0.991 116 243
AF-A0A3S4ZJ77-F1-model_v4 deleted 0.9888 1 243
AF-A0A519I982-F1-model_v4 Endonuclease 0.9881 1 243 GO:0003684
GO:0004519
GO:0006284
GO:0008270
GO:0019104
GO:0140078

Feature Viewer

pLDDT pTM Quality
95.69 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map