F234694

General Info

Members Datasets Scaffolds Average Seq Length
160 126 320 324

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10022889|Ga0213876_100228891
Length 355
Sequence MVDGAAGEEAALATRAKEGNLAVMSVPTTMRALEQTSLKGPQDLRLITDAPVPSXXXGEVLIRVTAAGINFVDISQAHGTFAGGPQPPYLAGIEGAGEVTAVGEGVTDLEPGAHVIGVGMGGGAFAQYMVLSAAAAVSVPAGWTDEQALGLLVSWPTALAAIKPLGCVAAGQTVLIHAAAGGTGQVAVKLAKHYGATVIATASPGKHAVVRAQGADHVIDSRAADLAAEVLRLTGGAGADLVLESVGGATLDASLAATKRVTGRVVVYGVVGGEAAITNWQLVYKHQIHVIGLNIGILIQAAPKIFGEVMGEMFGLLAAGVLGPGQPTAYDLADGPKALAELEARATVGKLALLP

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
87 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
120 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
121 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
122 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
123 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
124 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
125 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
126 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 1.25
Isolates 5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 11.88
Rhizosphere 76.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10022889 3300021384 Bacteria 3301
2 JGI24739J22299_10008567 3300001989 Bacteria 3818
3 JGI24737J22298_10015344 3300001990 Bacteria 2479
4 JGI25404J52841_10005713 3300003659 Bacteria 2574
5 Ga0070658_10171159 3300005327 Bacteria 1824
6 Ga0070683_100004149 3300005329 Bacteria 11870
7 Ga0070683_100022154 3300005329 Bacteria 5676
8 Ga0068869_100067991 3300005334 Bacteria 2630
9 Ga0070689_100019404 3300005340 Bacteria 5028
10 Ga0070687_100009919 3300005343 Bacteria 4096
11 Ga0070668_100104071 3300005347 Bacteria 2252
12 Ga0070667_100096925 3300005367 Bacteria 2544
13 Ga0070703_10013294 3300005406 Bacteria 2337
14 Ga0070713_100089987 3300005436 Bacteria 2638
15 Ga0070694_100062701 3300005444 Bacteria 2540
16 Ga0070708_100028941 3300005445 Bacteria 4772
17 Ga0070708_100089558 3300005445 Bacteria 2799
18 Ga0070663_100075105 3300005455 Bacteria 2469
19 Ga0070681_10113454 3300005458 Bacteria 2649
20 Ga0070707_100129490 3300005468 Bacteria 2453
21 Ga0070707_100364104 3300005468 Bacteria 1405
22 Ga0070698_100007730 3300005471 Bacteria 11630
23 Ga0070698_100207043 3300005471 Bacteria 1896
24 Ga0070699_100000761 3300005518 Bacteria 29760
25 Ga0070684_100048687 3300005535 Bacteria 3677
26 Ga0070684_100236524 3300005535 Bacteria 1668
27 Ga0070684_100273599 3300005535 Bacteria 1546
28 Ga0070697_100017235 3300005536 Bacteria 5680
29 Ga0070686_100087364 3300005544 Bacteria 2078
30 Ga0070696_100154899 3300005546 Bacteria 1684
31 Ga0070704_100162304 3300005549 Bacteria 1768
32 Ga0070664_100031911 3300005564 Bacteria 4405
33 Ga0068857_100022554 3300005577 Bacteria 5538
34 Ga0068857_100057706 3300005577 Bacteria 3446
35 Ga0068857_100172516 3300005577 Bacteria 1966
36 Ga0068859_100309785 3300005617 Bacteria 1672
37 Ga0068870_10005112 3300005840 Bacteria 5706
38 Ga0068860_100259814 3300005843 Bacteria 1692
39 Ga0068860_100435002 3300005843 Bacteria 1302
40 Ga0081455_10024177 3300005937 Bacteria 5634
41 Ga0081538_10027498 3300005981 Bacteria 3941
42 Ga0081540_1007283 3300005983 Bacteria 7921
43 Ga0081539_10013344 3300005985 Bacteria 6196
44 Ga0070717_10155019 3300006028 Bacteria 1983
45 Ga0070717_10166338 3300006028 Bacteria 1916
46 Ga0075364_10012577 3300006051 Bacteria 5184
47 Ga0075428_100097794 3300006844 Bacteria 3200
48 Ga0075430_100131667 3300006846 Bacteria 2084
49 Ga0075429_100337770 3300006880 Bacteria 1318
50 Ga0097620_100309777 3300006931 Bacteria 1672
51 Ga0075435_100208871 3300007076 Bacteria 1656
52 Ga0105240_10314895 3300009093 Bacteria 1786
53 Ga0111539_10007318 3300009094 Bacteria 14136
54 Ga0111539_10346493 3300009094 Bacteria 1729
55 Ga0105243_10093738 3300009148 Bacteria 2478
56 Ga0105242_10130107 3300009176 Bacteria 2171
57 Ga0157373_10171202 3300013100 Bacteria 1528
58 Ga0157371_10123721 3300013102 Bacteria 1839
59 Ga0157374_10087588 3300013296 Bacteria 2964
60 Ga0157378_10550335 3300013297 Bacteria 1159
61 Ga0157372_10092455 3300013307 Bacteria 3441
62 Ga0157375_10322371 3300013308 Bacteria 1710
63 Ga0163163_10026842 3300014325 Bacteria 5509
64 Ga0163163_10068468 3300014325 Bacteria 3532
65 Ga0163163_10091476 3300014325 Bacteria 3057
66 Ga0163163_10146409 3300014325 Bacteria 2406
67 Ga0206353_10822237 3300020082 Bacteria 2438
68 Ga0206353_10973098 3300020082 Bacteria 1180
69 Ga0213875_10001383 3300021388 Bacteria 15919
70 Ga0213875_10018925 3300021388 Bacteria 3315
71 Ga0207710_10009662 3300025900 Bacteria 4053
72 Ga0207688_10051370 3300025901 Bacteria 2309
73 Ga0207647_10006033 3300025904 Bacteria 8834
74 Ga0207647_10127461 3300025904 Bacteria 1497
75 Ga0207699_10014564 3300025906 Bacteria 4058
76 Ga0207705_10068322 3300025909 Bacteria 2573
77 Ga0207684_10092184 3300025910 Bacteria 2582
78 Ga0207654_10142919 3300025911 Bacteria 1528
79 Ga0207707_10294728 3300025912 Bacteria 1403
80 Ga0207693_10042588 3300025915 Bacteria 3574
81 Ga0207662_10014225 3300025918 Bacteria 4461
82 Ga0207657_10004108 3300025919 Bacteria 15454
83 Ga0207646_10198459 3300025922 Bacteria 1812
84 Ga0207694_10054112 3300025924 Bacteria 3113
85 Ga0207664_10011358 3300025929 Bacteria 6325
86 Ga0207686_10058552 3300025934 Bacteria 2429
87 Ga0207665_10076344 3300025939 Bacteria 2297
88 Ga0207691_10024944 3300025940 Bacteria 5618
89 Ga0207661_10001418 3300025944 Bacteria 16160
90 Ga0207661_10015605 3300025944 Bacteria 5594
91 Ga0207658_10117030 3300025986 Bacteria 2118
92 Ga0207703_10426194 3300026035 Bacteria 1235
93 Ga0207678_10018859 3300026067 Bacteria 6060
94 Ga0207678_10170866 3300026067 Bacteria 1856
95 Ga0207702_10228293 3300026078 Bacteria 1738
96 Ga0207676_10085847 3300026095 Bacteria 2569
97 Ga0207674_10012812 3300026116 Bacteria 9361
98 Ga0207674_10057739 3300026116 Bacteria 3934
99 Ga0207674_10200882 3300026116 Bacteria 1943
100 Ga0207675_100059586 3300026118 Bacteria 3562
101 Ga0307509_10102874 3300031507 Bacteria 2886
102 Ga0307516_10013387 3300031730 Bacteria 8748
103 Ga0307410_10191299 3300031852 Bacteria 1556
104 Ga0307406_10228222 3300031901 Bacteria 1389
105 Ga0307409_100103492 3300031995 Bacteria 2368
106 Ga0307415_100030242 3300032126 Bacteria 3473
107 Ga0307415_100114818 3300032126 Bacteria 2005
108 Ga0307415_100350566 3300032126 Bacteria 1242
109 Ga0373948_0013564 3300034817 Bacteria 1473
110 Ga0373942_0007253 3300035207 Bacteria 2569
111 Ga0373931_0014292 3300035691 Bacteria 3877
112 Ga0373935_0160798 3300035692 Bacteria 1531
113 Ga0373925_0000072 3300037068 Bacteria 106707
114 Ga0436364_0459261 3300037853 Bacteria 2250
115 Ga0436364_0923959 3300037853 Bacteria 2221
116 Ga0436364_1194546 3300037853 Bacteria 43227
117 Ga0436365_0136454 3300039437 Bacteria 6795
118 Ga0436365_1327609 3300039437 Bacteria 21571
119 Ga0436365_1487016 3300039437 Bacteria 1406
120 Ga0466972_0060371 3300044658 Bacteria 1819
121 Ga0466963_0047443 3300044694 Bacteria 2835
122 Ga0466970_0212065 3300044765 Bacteria 1079
123 Ga0466959_0085751 3300045049 Bacteria 2266
124 Ga0495652_0227247 3300046529 Bacteria 1398
125 Ga0495640_0038319 3300046533 Bacteria 3372
126 Ga0495635_0039545 3300046663 Bacteria 3262
127 Ga0495646_0092843 3300046680 Bacteria 1740
128 Ga0495674_0009514 3300047319 Bacteria 9232
129 Ga0495674_0104579 3300047319 Bacteria 2407
130 Ga0495593_0158831 3300047673 Bacteria 1142
131 Ga0496102_0189709 3300048905 Bacteria 1936
132 Ga0496103_0069504 3300048906 Bacteria 2201
133 Ga0496104_0050080 3300048907 Bacteria 3941
134 Ga0496105_0024982 3300048908 Bacteria 4857
135 Ga0496105_0027130 3300048908 Bacteria 4675
136 Ga0496106_0273141 3300048909 Bacteria 1353
137 Ga0496108_0039764 3300048911 Bacteria 3919
138 Ga0496109_0004048 3300048912 Bacteria 12245
139 Ga0496109_0039097 3300048912 Bacteria 4292
140 Ga0496110_0024113 3300048913 Bacteria 5183
141 Ga0496110_0026811 3300048913 Bacteria 4934
142 Ga0496111_0000363 3300048914 Bacteria 22534
143 Ga0496111_0002078 3300048914 Bacteria 11938
144 Ga0496111_0059002 3300048914 Bacteria 2779
145 Ga0496112_0101579 3300048915 Bacteria 2845
146 Ga0496113_0090137 3300048916 Bacteria 2361
147 Ga0496114_0125134 3300048917 Bacteria 2215
148 Ga0496114_0196391 3300048917 Bacteria 1766
149 Ga0496115_0050803 3300048918 Bacteria 3323
150 Ga0501038_0231583 3300049574 Bacteria 1470
151 Ga0501044_0101188 3300049823 Bacteria 2899
152 nmdc:mga08y16_42128_c1 3300050511 Bacteria 4782
153 2558909249 2558860112 Bacteria 9931328
154 2586060137 2585427649 Bacteria 9053857
155 2753267092 2751185782 Bacteria 11227053
156 2809590877 2808606522 Bacteria 9488490
157 2816507716 2816332139 Bacteria 9138787
158 2915771895 2915768154 Bacteria 8424322
159 2919713989 2919713450 Bacteria 7431245
160 3003000462 3002998708 Bacteria 11715108
161 Ga0213876_10022889
162 JGI24739J22299_10008567
163 JGI24737J22298_10015344
164 JGI25404J52841_10005713
165 Ga0070658_10171159
166 Ga0070683_100004149
167 Ga0070683_100022154
168 Ga0068869_100067991
169 Ga0070689_100019404
170 Ga0070687_100009919
171 Ga0070668_100104071
172 Ga0070667_100096925
173 Ga0070703_10013294
174 Ga0070713_100089987
175 Ga0070694_100062701
176 Ga0070708_100028941
177 Ga0070708_100089558
178 Ga0070663_100075105
179 Ga0070681_10113454
180 Ga0070707_100129490
181 Ga0070707_100364104
182 Ga0070698_100007730
183 Ga0070698_100207043
184 Ga0070699_100000761
185 Ga0070684_100048687
186 Ga0070684_100236524
187 Ga0070684_100273599
188 Ga0070697_100017235
189 Ga0070686_100087364
190 Ga0070696_100154899
191 Ga0070704_100162304
192 Ga0070664_100031911
193 Ga0068857_100022554
194 Ga0068857_100057706
195 Ga0068857_100172516
196 Ga0068859_100309785
197 Ga0068870_10005112
198 Ga0068860_100259814
199 Ga0068860_100435002
200 Ga0081455_10024177
201 Ga0081538_10027498
202 Ga0081540_1007283
203 Ga0081539_10013344
204 Ga0070717_10155019
205 Ga0070717_10166338
206 Ga0075364_10012577
207 Ga0075428_100097794
208 Ga0075430_100131667
209 Ga0075429_100337770
210 Ga0097620_100309777
211 Ga0075435_100208871
212 Ga0105240_10314895
213 Ga0111539_10007318
214 Ga0111539_10346493
215 Ga0105243_10093738
216 Ga0105242_10130107
217 Ga0157373_10171202
218 Ga0157371_10123721
219 Ga0157374_10087588
220 Ga0157378_10550335
221 Ga0157372_10092455
222 Ga0157375_10322371
223 Ga0163163_10026842
224 Ga0163163_10068468
225 Ga0163163_10091476
226 Ga0163163_10146409
227 Ga0206353_10822237
228 Ga0206353_10973098
229 Ga0213875_10001383
230 Ga0213875_10018925
231 Ga0207710_10009662
232 Ga0207688_10051370
233 Ga0207647_10006033
234 Ga0207647_10127461
235 Ga0207699_10014564
236 Ga0207705_10068322
237 Ga0207684_10092184
238 Ga0207654_10142919
239 Ga0207707_10294728
240 Ga0207693_10042588
241 Ga0207662_10014225
242 Ga0207657_10004108
243 Ga0207646_10198459
244 Ga0207694_10054112
245 Ga0207664_10011358
246 Ga0207686_10058552
247 Ga0207665_10076344
248 Ga0207691_10024944
249 Ga0207661_10001418
250 Ga0207661_10015605
251 Ga0207658_10117030
252 Ga0207703_10426194
253 Ga0207678_10018859
254 Ga0207678_10170866
255 Ga0207702_10228293
256 Ga0207676_10085847
257 Ga0207674_10012812
258 Ga0207674_10057739
259 Ga0207674_10200882
260 Ga0207675_100059586
261 Ga0307509_10102874
262 Ga0307516_10013387
263 Ga0307410_10191299
264 Ga0307406_10228222
265 Ga0307409_100103492
266 Ga0307415_100030242
267 Ga0307415_100114818
268 Ga0307415_100350566
269 Ga0373948_0013564
270 Ga0373942_0007253
271 Ga0373931_0014292
272 Ga0373935_0160798
273 Ga0373925_0000072
274 Ga0436364_0459261
275 Ga0436364_0923959
276 Ga0436364_1194546
277 Ga0436365_0136454
278 Ga0436365_1327609
279 Ga0436365_1487016
280 Ga0466972_0060371
281 Ga0466963_0047443
282 Ga0466970_0212065
283 Ga0466959_0085751
284 Ga0495652_0227247
285 Ga0495640_0038319
286 Ga0495635_0039545
287 Ga0495646_0092843
288 Ga0495674_0009514
289 Ga0495674_0104579
290 Ga0495593_0158831
291 Ga0496102_0189709
292 Ga0496103_0069504
293 Ga0496104_0050080
294 Ga0496105_0024982
295 Ga0496105_0027130
296 Ga0496106_0273141
297 Ga0496108_0039764
298 Ga0496109_0004048
299 Ga0496109_0039097
300 Ga0496110_0024113
301 Ga0496110_0026811
302 Ga0496111_0000363
303 Ga0496111_0002078
304 Ga0496111_0059002
305 Ga0496112_0101579
306 Ga0496113_0090137
307 Ga0496114_0125134
308 Ga0496114_0196391
309 Ga0496115_0050803
310 Ga0501038_0231583
311 Ga0501044_0101188
312 nmdc:mga08y16_42128_c1
313 2558909249
314 2586060137
315 2753267092
316 2809590877
317 2816507716
318 2915771895
319 2919713989
320 3003000462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

56

141

0.91

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

182

310

0.89

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

213

353

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rvu-assembly2.cif.gz_C the native structure of mycobacterial rv1454c complexed with nadph 0.9224 10 314
3jyl-assembly1.cif.gz_A crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase 0.9199 15 314
1qor-assembly1.cif.gz_B crystal structure of escherichia coli quinone oxidoreductase complexed with nadph 0.9134 15 314
4rvu-assembly2.cif.gz_B the native structure of mycobacterial rv1454c complexed with nadph 0.9114 10 314
3slk-assembly2.cif.gz_B structure of ketoreductase and enoylreductase didomain from modular polyketide synthase 0.9081 11 313
ID Description Score Start End Superfamily
af_O74489_128_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9269 126 255 3.40.50.720
3gmsA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9236 127 249 3.40.50.720
4rvuB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.921 116 255 3.40.50.720
af_B0BNC9_147_315_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9155 115 279 3.40.50.720
4eyeB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9152 114 280 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V6WRS4-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9448 12 314 GO:0003960
GO:0005829
GO:0035925
GO:0070402
AF-A0A399DWR7-F1-model_v4 2-haloacrylate reductase (EC 1.3.1.103) 0.932 134 314 GO:0102523
AF-A0A227J0B0-F1-model_v4 NADPH:quinone reductase 0.9294 99 183
AF-A0A126NTD3-F1-model_v4 Quinone oxidoreductase 0.929 11 314 GO:0003960
GO:0005829
GO:0008270
GO:0035925
GO:0070402
AF-A0A528FI11-F1-model_v4 Quinone oxidoreductase 0.9239 99 314 GO:0003960
GO:0005829
GO:0008270
GO:0035925
GO:0070402

Map