F231852

General Info

Members Datasets Scaffolds Average Seq Length
159 124 318 109

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100033543|Ga0075363_1000335432
Length 119
Sequence MDSTDTNTGTTASGLPVAFADLEPFAAWILDTQPKRYAQRLAAPMKDMQAFYDAAFPRLNEILEYCDQFPIDDLPDAVRRLMYLVFSLIEVSFPIEIWKQGRVPDSGAAAMDCILEPAV

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
8 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
9 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
35 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
36 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
37 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
38 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
39 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
40 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
41 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
42 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
43 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
44 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
45 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
46 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
47 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
48 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
49 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
50 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
51 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
52 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
53 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
54 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
55 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
56 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
57 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
58 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
59 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
60 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
61 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
62 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
63 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
64 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
65 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
66 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
67 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
68 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
69 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
72 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
73 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
74 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
75 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
78 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
79 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
80 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
81 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
82 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
89 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
104 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
112 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
113 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
114 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
115 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
116 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
117 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
120 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
121 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
123 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
124 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 0
Isolates 1.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.24
Nodule 0
Rhizoplane 8.81
Rhizosphere 69.18
Stem 0
Stem Tuber 0
Unclassified 3.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100033543 3300006048 Bacteria 2674
2 JGI25406J46586_10064427 3300003203 Bacteria 1171
3 Ga0070683_100763012 3300005329 Bacteria 927
4 Ga0070674_101054219 3300005356 Bacteria 716
5 Ga0070688_101463582 3300005365 Bacteria 555
6 Ga0070714_100004993 3300005435 Bacteria 10085
7 Ga0070714_100567576 3300005435 Bacteria 1088
8 Ga0070714_101289801 3300005435 Bacteria 713
9 Ga0070699_100644768 3300005518 Bacteria 967
10 Ga0070697_101534039 3300005536 Bacteria 595
11 Ga0068858_101679109 3300005842 Bacteria 627
12 Ga0081539_10010865 3300005985 Bacteria 7313
13 Ga0070717_10738466 3300006028 Bacteria 895
14 Ga0075365_10032974 3300006038 Bacteria 3334
15 Ga0075365_10587497 3300006038 Bacteria 788
16 Ga0075368_10346863 3300006042 Bacteria 646
17 Ga0075363_100138695 3300006048 Bacteria 1368
18 Ga0075363_100380286 3300006048 Unclassified 828
19 Ga0075364_11215646 3300006051 Bacteria 511
20 Ga0070716_101024714 3300006173 Bacteria 654
21 Ga0070712_101862472 3300006175 Bacteria 527
22 Ga0075362_10028423 3300006177 Bacteria 2402
23 Ga0075367_10039796 3300006178 Bacteria 2742
24 Ga0075367_10105258 3300006178 Bacteria 1728
25 Ga0075367_10142977 3300006178 Bacteria 1482
26 Ga0075369_10083339 3300006186 Bacteria 1420
27 Ga0075428_101584887 3300006844 Bacteria 685
28 Ga0068865_101693421 3300006881 Bacteria 570
29 Ga0105245_11470445 3300009098 Unclassified 732
30 Ga0105238_10802666 3300009551 Bacteria 957
31 Ga0105239_12194037 3300010375 Bacteria 642
32 Ga0105246_11944123 3300011119 Bacteria 566
33 Ga0163162_10585518 3300013306 Bacteria 1242
34 Ga0163162_11075998 3300013306 Bacteria 911
35 Ga0157372_11790785 3300013307 Bacteria 706
36 Ga0157375_10188629 3300013308 Bacteria 2216
37 Ga0157380_10120961 3300014326 Bacteria 2218
38 Ga0207663_10833401 3300025916 Bacteria 736
39 Ga0207686_11838118 3300025934 Unclassified 502
40 Ga0207658_10036213 3300025986 Bacteria 3538
41 Ga0207677_11406393 3300026023 Bacteria 643
42 Ga0209813_10105734 3300027866 Bacteria 963
43 Ga0307512_10059658 3300030522 Bacteria 2958
44 Ga0265327_10042998 3300031251 Bacteria 2422
45 Ga0265327_10058815 3300031251 Bacteria 1971
46 Ga0316579_10349279 3300031691 Bacteria 715
47 Ga0316576_10116788 3300031727 Bacteria 2002
48 Ga0316576_10709073 3300031727 Bacteria 729
49 Ga0316578_10171159 3300031728 Bacteria 1309
50 Ga0316578_10387487 3300031728 Bacteria 829
51 Ga0307413_11789967 3300031824 Bacteria 550
52 Ga0307416_100258946 3300032002 Bacteria 1699
53 Ga0307416_100796181 3300032002 Bacteria 1041
54 Ga0307411_11925463 3300032005 Bacteria 551
55 Ga0307415_101362484 3300032126 Bacteria 674
56 Ga0307415_101723301 3300032126 Bacteria 605
57 Ga0373938_0018984 3300034957 Bacteria 1371
58 Ga0373939_0236552 3300035114 Bacteria 705
59 Ga0373953_0061893 3300035117 Bacteria 1531
60 Ga0373953_0110624 3300035117 Bacteria 1161
61 Ga0373954_0060132 3300035118 Bacteria 1792
62 Ga0373956_0014269 3300035119 Bacteria 3318
63 Ga0373962_0126824 3300035242 Bacteria 818
64 Ga0316574_0619042 3300035398 Bacteria 668
65 Ga0373924_0160805 3300035410 Bacteria 985
66 Ga0373924_0247512 3300035410 Bacteria 789
67 Ga0373935_1065918 3300035692 Bacteria 601
68 Ga0373933_0054464 3300035724 Bacteria 2397
69 Ga0373937_0285300 3300036401 Bacteria 1559
70 Ga0316584_0054052 3300036712 Bacteria 3005
71 Ga0316584_0107952 3300036712 Bacteria 2083
72 Ga0316584_0141043 3300036712 Bacteria 1797
73 Ga0436365_0993148 3300039437 Bacteria 1382
74 Ga0436365_1489980 3300039437 Bacteria 674
75 Ga0436363_0506484 3300039450 Bacteria 849
76 Ga0436363_1240299 3300039450 Bacteria 3871
77 Ga0439447_062077 3300041407 Bacteria 878
78 Ga0439466_0049611 3300041411 Bacteria 1378
79 Ga0451787_550118 3300041441 Bacteria 645
80 Ga0451789_1219097 3300041443 Bacteria 959
81 Ga0451793_0881454 3300041452 Bacteria 1063
82 Ga0451797_0451372 3300041453 Bacteria 637
83 Ga0451795_1642714 3300041456 Bacteria 524
84 Ga0451843_0275652 3300041509 Bacteria 668
85 Ga0439445_0169002 3300042004 Bacteria 640
86 Ga0439452_089366 3300042010 Bacteria 666
87 Ga0439452_110363 3300042010 Bacteria 588
88 Ga0439446_0365216 3300042156 Bacteria 516
89 Ga0439460_0273251 3300042461 Bacteria 587
90 Ga0466967_1582276 3300045976 Bacteria 653
91 Ga0495629_0103314 3300046459 Bacteria 1988
92 Ga0495641_0566526 3300046461 Bacteria 519
93 Ga0495653_0422795 3300046463 Bacteria 843
94 Ga0495583_0088670 3300046506 Bacteria 1335
95 Ga0495618_0060936 3300046514 Bacteria 2393
96 Ga0495630_0033784 3300046517 Bacteria 3815
97 Ga0495640_0077652 3300046533 Bacteria 2213
98 Ga0495586_0020542 3300046535 Bacteria 3516
99 Ga0495586_0295978 3300046535 Bacteria 927
100 Ga0495587_0044944 3300046536 Bacteria 2626
101 Ga0495621_0027265 3300046539 Bacteria 1933
102 Ga0495634_0035027 3300046642 Bacteria 3441
103 Ga0495635_0175263 3300046663 Bacteria 1458
104 Ga0495658_0125878 3300046683 Bacteria 1555
105 Ga0495613_0000365 3300046689 Bacteria 39454
106 Ga0495613_1036298 3300046689 Bacteria 526
107 Ga0495624_0343216 3300046690 Bacteria 898
108 Ga0495604_0540952 3300047317 Bacteria 752
109 Ga0495676_1059797 3300047321 Bacteria 516
110 Ga0495680_0078124 3300047322 Bacteria 2505
111 Ga0495680_0759116 3300047322 Bacteria 636
112 Ga0495593_0080569 3300047673 Bacteria 1684
113 Ga0496102_0800779 3300048905 Bacteria 865
114 Ga0496104_1340530 3300048907 Bacteria 619
115 Ga0496108_0255400 3300048911 Bacteria 1525
116 Ga0496108_0592910 3300048911 Bacteria 966
117 Ga0496109_0710146 3300048912 Bacteria 943
118 Ga0496110_0292139 3300048913 Bacteria 1485
119 Ga0496113_1322284 3300048916 Bacteria 560
120 Ga0496114_0685055 3300048917 Bacteria 900
121 Ga0496114_1764989 3300048917 Bacteria 507
122 Ga0501036_0567901 3300049572 Bacteria 942
123 Ga0501039_0661480 3300049575 Bacteria 818
124 Ga0501039_1474120 3300049575 Bacteria 523
125 Ga0501040_0992231 3300049576 Bacteria 609
126 Ga0501040_1122269 3300049576 Bacteria 570
127 Ga0501041_0863520 3300049577 Bacteria 581
128 Ga0501042_0411555 3300049578 Bacteria 980
129 Ga0501042_1090956 3300049578 Bacteria 582
130 Ga0501048_0974403 3300049582 Bacteria 610
131 Ga0501067_0065018 3300049583 Bacteria 2019
132 Ga0501068_0101101 3300049584 Bacteria 1787
133 Ga0501071_0186689 3300049587 Bacteria 1554
134 Ga0501073_0451201 3300049589 Bacteria 889
135 Ga0501075_0606747 3300049591 Bacteria 835
136 Ga0501077_0161930 3300049593 Bacteria 1421
137 Ga0501080_0615769 3300049742 Bacteria 963
138 Ga0501035_0670245 3300049822 Bacteria 839
139 nmdc:mga03683_40822_c1 3300050489 Bacteria 1904
140 nmdc:mga03n38_116363_c1 3300050490 Bacteria 1308
141 nmdc:mga03n38_266967_c1 3300050490 Bacteria 909
142 nmdc:mga03n38_373749_c1 3300050490 Unclassified 780
143 nmdc:mga03n38_86353_c1 3300050490 Bacteria 1485
144 nmdc:mga00v17_32312_c1 3300050491 Bacteria 3093
145 nmdc:mga0yw44_368770_c1 3300050492 Bacteria 968
146 nmdc:mga0yw44_424907_c1 3300050492 Bacteria 900
147 nmdc:mga0yw44_668_c1 3300050492 Bacteria 12506
148 nmdc:mga06z11_30366_c1 3300050494 Bacteria 2614
149 nmdc:mga06z11_366561_c1 3300050494 Unclassified 864
150 nmdc:mga06z11_95914_c1 3300050494 Bacteria 1619
151 Ga0500635_0042258 3300053080 Bacteria 1528
152 Ga0495595_0330119 3300053084 Bacteria 769
153 Ga0495619_0199467 3300053085 Bacteria 1385
154 Ga0500566_0333122 3300053094 Bacteria 702
155 Ga0500555_076834 3300053103 Bacteria 873
156 Ga0500600_0327518 3300053149 Bacteria 642
157 Ga0530510_0979997 3300061734 Bacteria 647
158 2523383403 2523231044 Bacteria 6434991
159 2919713530 2919713450 Bacteria 7431245
160 Ga0075363_100033543
161 JGI25406J46586_10064427
162 Ga0070683_100763012
163 Ga0070674_101054219
164 Ga0070688_101463582
165 Ga0070714_100004993
166 Ga0070714_100567576
167 Ga0070714_101289801
168 Ga0070699_100644768
169 Ga0070697_101534039
170 Ga0068858_101679109
171 Ga0081539_10010865
172 Ga0070717_10738466
173 Ga0075365_10032974
174 Ga0075365_10587497
175 Ga0075368_10346863
176 Ga0075363_100138695
177 Ga0075363_100380286
178 Ga0075364_11215646
179 Ga0070716_101024714
180 Ga0070712_101862472
181 Ga0075362_10028423
182 Ga0075367_10039796
183 Ga0075367_10105258
184 Ga0075367_10142977
185 Ga0075369_10083339
186 Ga0075428_101584887
187 Ga0068865_101693421
188 Ga0105245_11470445
189 Ga0105238_10802666
190 Ga0105239_12194037
191 Ga0105246_11944123
192 Ga0163162_10585518
193 Ga0163162_11075998
194 Ga0157372_11790785
195 Ga0157375_10188629
196 Ga0157380_10120961
197 Ga0207663_10833401
198 Ga0207686_11838118
199 Ga0207658_10036213
200 Ga0207677_11406393
201 Ga0209813_10105734
202 Ga0307512_10059658
203 Ga0265327_10042998
204 Ga0265327_10058815
205 Ga0316579_10349279
206 Ga0316576_10116788
207 Ga0316576_10709073
208 Ga0316578_10171159
209 Ga0316578_10387487
210 Ga0307413_11789967
211 Ga0307416_100258946
212 Ga0307416_100796181
213 Ga0307411_11925463
214 Ga0307415_101362484
215 Ga0307415_101723301
216 Ga0373938_0018984
217 Ga0373939_0236552
218 Ga0373953_0061893
219 Ga0373953_0110624
220 Ga0373954_0060132
221 Ga0373956_0014269
222 Ga0373962_0126824
223 Ga0316574_0619042
224 Ga0373924_0160805
225 Ga0373924_0247512
226 Ga0373935_1065918
227 Ga0373933_0054464
228 Ga0373937_0285300
229 Ga0316584_0054052
230 Ga0316584_0107952
231 Ga0316584_0141043
232 Ga0436365_0993148
233 Ga0436365_1489980
234 Ga0436363_0506484
235 Ga0436363_1240299
236 Ga0439447_062077
237 Ga0439466_0049611
238 Ga0451787_550118
239 Ga0451789_1219097
240 Ga0451793_0881454
241 Ga0451797_0451372
242 Ga0451795_1642714
243 Ga0451843_0275652
244 Ga0439445_0169002
245 Ga0439452_089366
246 Ga0439452_110363
247 Ga0439446_0365216
248 Ga0439460_0273251
249 Ga0466967_1582276
250 Ga0495629_0103314
251 Ga0495641_0566526
252 Ga0495653_0422795
253 Ga0495583_0088670
254 Ga0495618_0060936
255 Ga0495630_0033784
256 Ga0495640_0077652
257 Ga0495586_0020542
258 Ga0495586_0295978
259 Ga0495587_0044944
260 Ga0495621_0027265
261 Ga0495634_0035027
262 Ga0495635_0175263
263 Ga0495658_0125878
264 Ga0495613_0000365
265 Ga0495613_1036298
266 Ga0495624_0343216
267 Ga0495604_0540952
268 Ga0495676_1059797
269 Ga0495680_0078124
270 Ga0495680_0759116
271 Ga0495593_0080569
272 Ga0496102_0800779
273 Ga0496104_1340530
274 Ga0496108_0255400
275 Ga0496108_0592910
276 Ga0496109_0710146
277 Ga0496110_0292139
278 Ga0496113_1322284
279 Ga0496114_0685055
280 Ga0496114_1764989
281 Ga0501036_0567901
282 Ga0501039_0661480
283 Ga0501039_1474120
284 Ga0501040_0992231
285 Ga0501040_1122269
286 Ga0501041_0863520
287 Ga0501042_0411555
288 Ga0501042_1090956
289 Ga0501048_0974403
290 Ga0501067_0065018
291 Ga0501068_0101101
292 Ga0501071_0186689
293 Ga0501073_0451201
294 Ga0501075_0606747
295 Ga0501077_0161930
296 Ga0501080_0615769
297 Ga0501035_0670245
298 nmdc:mga03683_40822_c1
299 nmdc:mga03n38_116363_c1
300 nmdc:mga03n38_266967_c1
301 nmdc:mga03n38_373749_c1
302 nmdc:mga03n38_86353_c1
303 nmdc:mga00v17_32312_c1
304 nmdc:mga0yw44_368770_c1
305 nmdc:mga0yw44_424907_c1
306 nmdc:mga0yw44_668_c1
307 nmdc:mga06z11_30366_c1
308 nmdc:mga06z11_366561_c1
309 nmdc:mga06z11_95914_c1
310 Ga0500635_0042258
311 Ga0495595_0330119
312 Ga0495619_0199467
313 Ga0500566_0333122
314 Ga0500555_076834
315 Ga0500600_0327518
316 Ga0530510_0979997
317 2523383403
318 2919713530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v9k-assembly2.cif.gz_D2 70s ribosome translocation intermediate gdpnp-i containing elongation factor efg/gdpnp, mrna, and trna bound in the pe*/e state. 0.4996 23 86
4v9k-assembly2.cif.gz_D2 70s ribosome translocation intermediate gdpnp-i containing elongation factor efg/gdpnp, mrna, and trna bound in the pe*/e state. 0.4572 23 86
7m5t-assembly1.cif.gz_A solution nmr structure of de novo designed protein 0515 0.4242 6 80
1wr6-assembly4.cif.gz_D crystal structure of gga3 gat domain in complex with ubiquitin 0.4216 7 89
1wr6-assembly4.cif.gz_D crystal structure of gga3 gat domain in complex with ubiquitin 0.3937 7 89
ID Description Score Start End Superfamily
af_O80742_363_643_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7075 39 81 1.25.10.10
af_Q8IYW2_796_995_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6141 35 80 1.25.40.10
af_A4HX62_1028_1296_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5799 25 82 1.25.40.10
af_A0A0N7KKM4_1_211_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5272 55 106 1.25.40.10
af_F4IBR2_1786_1976_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4938 32 86 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A3D5DEC4-F1-model_v4 Uncharacterized protein 0.987 4 86
AF-A0A2N4X260-F1-model_v4 Uncharacterized protein 0.9798 1 87
AF-A0A0Q8RF51-F1-model_v4 Acyl-CoA dehydrogenase 0.9705 1 91
AF-A0A2S8LR37-F1-model_v4 deleted 0.9698 1 89
AF-A0A4S3KB17-F1-model_v4 Uncharacterized protein 0.9696 1 95

Map