F231594

General Info

Members Datasets Scaffolds Average Seq Length
159 95 159 92

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100534388|Ga0070706_1005343881
Length 106
Sequence MRRLVQKVISRMKSAYELAMERLEKSSPSVALTEEQKKEIAEVDSMYRAKIAEKELFLKDQIRKVQAAGKFDEVESLEKQLSSEIRRLQEECEAKKEKLRASFASG

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
73 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
74 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
84 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
85 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
86 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
87 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
92 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
93 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
94 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
95 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.03
Rhizosphere 94.34
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10108622 3300005290 Bacteria 1871
2 Ga0065712_10122267 3300005290 Unclassified 1654
3 Ga0065712_10393058 3300005290 Unclassified 739
4 Ga0065715_10004587 3300005293 Bacteria 6348
5 Ga0065715_10122029 3300005293 Bacteria 2209
6 Ga0065715_10204997 3300005293 Bacteria 1342
7 Ga0065715_10792538 3300005293 Unclassified 613
8 Ga0070690_101108615 3300005330 Bacteria 628
9 Ga0070670_100028075 3300005331 Bacteria 4842
10 Ga0070670_100039890 3300005331 Unclassified 4038
11 Ga0070666_10132524 3300005335 Unclassified 1732
12 Ga0070689_100045664 3300005340 Bacteria 3374
13 Ga0070669_100563024 3300005353 Unclassified 951
14 Ga0070669_101178411 3300005353 Unclassified 661
15 Ga0070675_100053872 3300005354 Unclassified 3309
16 Ga0070671_100059820 3300005355 Unclassified 3171
17 Ga0070673_100717102 3300005364 Unclassified 919
18 Ga0070688_100024814 3300005365 Bacteria 3543
19 Ga0070667_100194546 3300005367 Unclassified 1797
20 Ga0070710_10032258 3300005437 Unclassified 2836
21 Ga0070711_100159105 3300005439 Unclassified 1711
22 Ga0070711_100202817 3300005439 Bacteria 1531
23 Ga0070708_100241336 3300005445 Unclassified 1696
24 Ga0070708_100379351 3300005445 Unclassified 1333
25 Ga0070708_100509097 3300005445 Bacteria 1136
26 Ga0070708_101031184 3300005445 Bacteria 771
27 Ga0070708_101089131 3300005445 Bacteria 748
28 Ga0070678_101160682 3300005456 Unclassified 715
29 Ga0070678_101277924 3300005456 Unclassified 682
30 Ga0070678_101797757 3300005456 Unclassified 578
31 Ga0070662_101393262 3300005457 Unclassified 604
32 Ga0070706_100000311 3300005467 Bacteria 59149
33 Ga0070706_100013504 3300005467 Bacteria 7554
34 Ga0070706_100059127 3300005467 Bacteria 3537
35 Ga0070706_100525822 3300005467 Bacteria 1100
36 Ga0070706_100534388 3300005467 Bacteria 1091
37 Ga0070707_100018878 3300005468 Bacteria 6493
38 Ga0070707_100129565 3300005468 Bacteria 2452
39 Ga0070707_101018255 3300005468 Bacteria 794
40 Ga0070707_101647861 3300005468 Unclassified 608
41 Ga0070698_100027760 3300005471 Bacteria 5883
42 Ga0070698_100386076 3300005471 Bacteria 1333
43 Ga0070698_100791900 3300005471 Bacteria 892
44 Ga0070698_100992482 3300005471 Bacteria 787
45 Ga0070697_100085730 3300005536 Bacteria 2599
46 Ga0070697_100124038 3300005536 Bacteria 2163
47 Ga0070697_100439164 3300005536 Unclassified 1136
48 Ga0070697_101253767 3300005536 Unclassified 661
49 Ga0070697_101326196 3300005536 Unclassified 642
50 Ga0070697_101424885 3300005536 Bacteria 619
51 Ga0070697_101457244 3300005536 Unclassified 612
52 Ga0070672_101974910 3300005543 Unclassified 525
53 Ga0070695_100952671 3300005545 Bacteria 696
54 Ga0070665_100183639 3300005548 Bacteria 2092
55 Ga0070704_101896595 3300005549 Unclassified 552
56 Ga0068863_100138129 3300005841 Bacteria 2328
57 Ga0068858_100698018 3300005842 Unclassified 987
58 Ga0068858_101285640 3300005842 Bacteria 720
59 Ga0081455_10185621 3300005937 Bacteria 1571
60 Ga0081455_10679364 3300005937 Unclassified 659
61 Ga0081539_10001132 3300005985 Bacteria 48398
62 Ga0081539_10026692 3300005985 Unclassified 3677
63 Ga0081539_10126646 3300005985 Bacteria 1260
64 Ga0070717_10000772 3300006028 Bacteria 20933
65 Ga0070717_10450830 3300006028 Unclassified 1159
66 Ga0070715_10007659 3300006163 Bacteria 3728
67 Ga0070715_10039048 3300006163 Unclassified 1975
68 Ga0070712_100137358 3300006175 Bacteria 1860
69 Ga0070712_100339777 3300006175 Unclassified 1226
70 Ga0070712_100773179 3300006175 Unclassified 823
71 Ga0075428_101309722 3300006844 Unclassified 762
72 Ga0075433_10634687 3300006852 Bacteria 937
73 Ga0068865_100995310 3300006881 Bacteria 734
74 Ga0099794_10589196 3300007265 Bacteria 588
75 Ga0105240_10276983 3300009093 Unclassified 1929
76 Ga0111539_10567343 3300009094 Bacteria 1322
77 Ga0105247_10484263 3300009101 Bacteria 898
78 Ga0114129_11575148 3300009147 Bacteria 805
79 Ga0105248_10432435 3300009177 Bacteria 1482
80 Ga0105237_12319904 3300009545 Unclassified 546
81 Ga0105249_10743390 3300009553 Bacteria 1043
82 Ga0105239_13548550 3300010375 Unclassified 507
83 Ga0157374_10186765 3300013296 Bacteria 2027
84 Ga0157374_10222520 3300013296 Unclassified 1852
85 Ga0157374_10362356 3300013296 Bacteria 1442
86 Ga0157374_10788582 3300013296 Bacteria 966
87 Ga0157374_11142014 3300013296 Bacteria 800
88 Ga0157378_13226081 3300013297 Bacteria 507
89 Ga0163162_10024550 3300013306 Bacteria 5952
90 Ga0163162_10035834 3300013306 Unclassified 4942
91 Ga0157375_10003557 3300013308 Bacteria 13524
92 Ga0157375_10306621 3300013308 Bacteria 1752
93 Ga0157375_12677494 3300013308 Bacteria 596
94 Ga0163163_10271516 3300014325 Bacteria 1747
95 Ga0157379_10289180 3300014968 Bacteria 1492
96 Ga0157376_10203768 3300014969 Unclassified 1822
97 Ga0207697_10001294 3300025315 Bacteria 13739
98 Ga0207697_10109571 3300025315 Bacteria 1182
99 Ga0207697_10218302 3300025315 Unclassified 841
100 Ga0207692_10160901 3300025898 Bacteria 1294
101 Ga0207680_10009721 3300025903 Bacteria 4783
102 Ga0207685_10006300 3300025905 Bacteria 3220
103 Ga0207684_10000337 3300025910 Bacteria 65590
104 Ga0207684_10013368 3300025910 Bacteria 7101
105 Ga0207684_10018026 3300025910 Bacteria 6052
106 Ga0207684_10220104 3300025910 Bacteria 1638
107 Ga0207684_10262344 3300025910 Unclassified 1491
108 Ga0207671_11422218 3300025914 Unclassified 537
109 Ga0207693_10048945 3300025915 Bacteria 3319
110 Ga0207693_10085374 3300025915 Unclassified 2473
111 Ga0207693_10347361 3300025915 Bacteria 1161
112 Ga0207693_10874578 3300025915 Unclassified 690
113 Ga0207646_10010612 3300025922 Bacteria 8972
114 Ga0207646_10063955 3300025922 Bacteria 3284
115 Ga0207646_10304421 3300025922 Bacteria 1440
116 Ga0207646_11084095 3300025922 Unclassified 705
117 Ga0207681_11014497 3300025923 Bacteria 696
118 Ga0207650_10226557 3300025925 Unclassified 1506
119 Ga0207650_10956089 3300025925 Bacteria 728
120 Ga0207659_10289087 3300025926 Unclassified 1343
121 Ga0207700_11243452 3300025928 Unclassified 664
122 Ga0207706_11195113 3300025933 Unclassified 632
123 Ga0207670_10057970 3300025936 Bacteria 2629
124 Ga0207665_10365862 3300025939 Bacteria 1091
125 Ga0207651_11033421 3300025960 Archaea 735
126 Ga0207668_10250147 3300025972 Bacteria 1439
127 Ga0207658_10275843 3300025986 Unclassified 1439
128 Ga0207703_10408952 3300026035 Bacteria 1260
129 Ga0207703_10594738 3300026035 Unclassified 1046
130 Ga0268266_11699313 3300028379 Bacteria 606
131 Ga0373958_0171551 3300034819 Unclassified 554
132 Ga0373945_0057008 3300035116 Bacteria 1450
133 Ga0373953_0234103 3300035117 Unclassified 797
134 Ga0373935_0039023 3300035692 Bacteria 2975
135 Ga0373935_0146839 3300035692 Bacteria 1597
136 Ga0373935_0491426 3300035692 Bacteria 890
137 Ga0373927_0218084 3300035695 Bacteria 1253
138 Ga0373947_0023098 3300035725 Bacteria 3615
139 Ga0373947_0032869 3300035725 Bacteria 3060
140 Ga0373925_0041184 3300037068 Bacteria 3423
141 Ga0373925_1216395 3300037068 Bacteria 619
142 Ga0395898_0639120 3300037466 Bacteria 1007
143 Ga0436365_1267311 3300039437 Bacteria 683
144 Ga0439454_077784 3300042011 Unclassified 597
145 Ga0451577_0007267 3300042876 Bacteria 10909
146 Ga0495602_0733593 3300048088 Bacteria 668
147 Ga0496100_0763073 3300048903 Bacteria 757
148 Ga0496105_0454082 3300048908 Bacteria 1011
149 Ga0496106_0872234 3300048909 Bacteria 712
150 Ga0496107_0387810 3300048910 Unclassified 1039
151 Ga0496109_0005413 3300048912 Bacteria 10676
152 Ga0496112_0022025 3300048915 Bacteria 6067
153 Ga0496113_0003628 3300048916 Bacteria 9275
154 Ga0496115_0149342 3300048918 Bacteria 1929
155 nmdc:mga05p37_1079072_c1 3300050507 Bacteria 843
156 nmdc:mga08y16_505440_c1 3300050511 Bacteria 1227
157 nmdc:mga0n895_752553_c1 3300050512 Bacteria 967
158 nmdc:mga0n895_890463_c1 3300050512 Bacteria 876
159 nmdc:mga0a205_131151_c1 3300050515 Bacteria 2406

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_13226081 Ga0157378_132260811 70
2 3300025926 Ga0207659_10289087 Ga0207659_102890872 72
3 3300025986 Ga0207658_10275843 Ga0207658_102758432 72
4 3300005842 Ga0068858_100698018 Ga0068858_1006980182 77
5 3300026035 Ga0207703_10594738 Ga0207703_105947382 77
6 3300005290 Ga0065712_10122267 Ga0065712_101222672 78
7 3300005331 Ga0070670_100039890 Ga0070670_1000398902 78
8 3300005335 Ga0070666_10132524 Ga0070666_101325242 78
9 3300005353 Ga0070669_100563024 Ga0070669_1005630242 78
10 3300005354 Ga0070675_100053872 Ga0070675_1000538722 78
11 3300005355 Ga0070671_100059820 Ga0070671_1000598202 78
12 3300005364 Ga0070673_100717102 Ga0070673_1007171022 78
13 3300005367 Ga0070667_100194546 Ga0070667_1001945462 78
14 3300005456 Ga0070678_101160682 Ga0070678_1011606821 78
15 3300005548 Ga0070665_100183639 Ga0070665_1001836392 78
16 3300013306 Ga0163162_10024550 Ga0163162_100245505 78
17 3300013308 Ga0157375_10003557 Ga0157375_100035576 78
18 3300014969 Ga0157376_10203768 Ga0157376_102037682 78
19 3300025903 Ga0207680_10009721 Ga0207680_100097216 78
20 3300025925 Ga0207650_10226557 Ga0207650_102265572 78
21 3300025960 Ga0207651_11033421 Ga0207651_110334211 78
22 3300028379 Ga0268266_11699313 Ga0268266_116993131 78
23 3300005468 Ga0070707_101647861 Ga0070707_1016478611 85
24 3300025910 Ga0207684_10220104 Ga0207684_102201042 85
25 3300025922 Ga0207646_11084095 Ga0207646_110840951 85
26 3300005330 Ga0070690_101108615 Ga0070690_1011086152 86
27 3300005467 Ga0070706_100000311 Ga0070706_10000031111 86
28 3300025923 Ga0207681_11014497 Ga0207681_110144971 86
29 3300025925 Ga0207650_10956089 Ga0207650_109560891 86
30 3300005841 Ga0068863_100138129 Ga0068863_1001381292 87
31 3300005842 Ga0068858_101285640 Ga0068858_1012856402 87
32 3300005937 Ga0081455_10679364 Ga0081455_106793642 87
33 3300025936 Ga0207670_10057970 Ga0207670_100579703 87
34 3300034819 Ga0373958_0171551 Ga0373958_0171551_48_323 91
35 3300009093 Ga0105240_10276983 Ga0105240_102769833 92
36 3300048088 Ga0495602_0733593 Ga0495602_0733593_319_600 93
37 3300005290 Ga0065712_10393058 Ga0065712_103930581 94
38 3300005293 Ga0065715_10792538 Ga0065715_107925381 94
39 3300005331 Ga0070670_100028075 Ga0070670_1000280752 94
40 3300005353 Ga0070669_101178411 Ga0070669_1011784112 94
41 3300005445 Ga0070708_100241336 Ga0070708_1002413363 94
42 3300005445 Ga0070708_100379351 Ga0070708_1003793511 94
43 3300005445 Ga0070708_101089131 Ga0070708_1010891312 94
44 3300005456 Ga0070678_101277924 Ga0070678_1012779241 94
45 3300005467 Ga0070706_100013504 Ga0070706_1000135042 94
46 3300005467 Ga0070706_100059127 Ga0070706_1000591272 94
47 3300005467 Ga0070706_100525822 Ga0070706_1005258222 94
48 3300005468 Ga0070707_100018878 Ga0070707_1000188788 94
49 3300005471 Ga0070698_100027760 Ga0070698_1000277608 94
50 3300005471 Ga0070698_100791900 Ga0070698_1007919001 94
51 3300005471 Ga0070698_100992482 Ga0070698_1009924822 94
52 3300005536 Ga0070697_100085730 Ga0070697_1000857302 94
53 3300005536 Ga0070697_100439164 Ga0070697_1004391641 94
54 3300005536 Ga0070697_101253767 Ga0070697_1012537671 94
55 3300005536 Ga0070697_101326196 Ga0070697_1013261961 94
56 3300005536 Ga0070697_101457244 Ga0070697_1014572442 94
57 3300005543 Ga0070672_101974910 Ga0070672_1019749102 94
58 3300005549 Ga0070704_101896595 Ga0070704_1018965952 94
59 3300006028 Ga0070717_10000772 Ga0070717_1000077219 94
60 3300006175 Ga0070712_100773179 Ga0070712_1007731791 94
61 3300006881 Ga0068865_100995310 Ga0068865_1009953102 94
62 3300007265 Ga0099794_10589196 Ga0099794_105891961 94
63 3300009545 Ga0105237_12319904 Ga0105237_123199042 94
64 3300013296 Ga0157374_10222520 Ga0157374_102225203 94
65 3300013306 Ga0163162_10035834 Ga0163162_100358342 94
66 3300013308 Ga0157375_12677494 Ga0157375_126774942 94
67 3300025315 Ga0207697_10001294 Ga0207697_100012947 94
68 3300025910 Ga0207684_10000337 Ga0207684_1000033713 94
69 3300025910 Ga0207684_10013368 Ga0207684_100133683 94
70 3300025910 Ga0207684_10018026 Ga0207684_100180267 94
71 3300025910 Ga0207684_10262344 Ga0207684_102623442 94
72 3300025914 Ga0207671_11422218 Ga0207671_114222182 94
73 3300025915 Ga0207693_10874578 Ga0207693_108745781 94
74 3300025922 Ga0207646_10063955 Ga0207646_100639554 94
75 3300025972 Ga0207668_10250147 Ga0207668_102501472 94
76 3300035117 Ga0373953_0234103 Ga0373953_0234103_68_352 94
77 3300035692 Ga0373935_0039023 Ga0373935_0039023_1675_1959 94
78 3300035725 Ga0373947_0032869 Ga0373947_0032869_2571_2855 94
79 3300037068 Ga0373925_1216395 Ga0373925_1216395_11_295 94
80 3300037466 Ga0395898_0639120 Ga0395898_0639120_613_897 94
81 3300039437 Ga0436365_1267311 Ga0436365_1267311_49_333 94
82 3300042011 Ga0439454_077784 Ga0439454_077784_116_400 94
83 3300042876 Ga0451577_0007267 Ga0451577_0007267_5297_5605 94
84 3300050512 nmdc:mga0n895_890463_c1 nmdc:mga0n895_890463_c1_323_607 94
85 3300005293 Ga0065715_10004587 Ga0065715_100045872 95
86 3300005340 Ga0070689_100045664 Ga0070689_1000456643 95
87 3300005365 Ga0070688_100024814 Ga0070688_1000248144 95
88 3300005445 Ga0070708_101031184 Ga0070708_1010311841 95
89 3300005457 Ga0070662_101393262 Ga0070662_1013932621 95
90 3300005467 Ga0070706_100534388 Ga0070706_1005343881 95
91 3300005545 Ga0070695_100952671 Ga0070695_1009526712 95
92 3300005937 Ga0081455_10185621 Ga0081455_101856212 95
93 3300005985 Ga0081539_10001132 Ga0081539_1000113242 95
94 3300005985 Ga0081539_10026692 Ga0081539_100266922 95
95 3300005985 Ga0081539_10126646 Ga0081539_101266462 95
96 3300006163 Ga0070715_10007659 Ga0070715_100076592 95
97 3300006175 Ga0070712_100137358 Ga0070712_1001373582 95
98 3300009101 Ga0105247_10484263 Ga0105247_104842632 95
99 3300009177 Ga0105248_10432435 Ga0105248_104324352 95
100 3300013296 Ga0157374_10186765 Ga0157374_101867652 95
101 3300013296 Ga0157374_10788582 Ga0157374_107885821 95
102 3300013296 Ga0157374_11142014 Ga0157374_111420142 95
103 3300014325 Ga0163163_10271516 Ga0163163_102715161 95
104 3300014968 Ga0157379_10289180 Ga0157379_102891802 95
105 3300025315 Ga0207697_10218302 Ga0207697_102183021 95
106 3300025898 Ga0207692_10160901 Ga0207692_101609011 95
107 3300025905 Ga0207685_10006300 Ga0207685_100063002 95
108 3300025915 Ga0207693_10048945 Ga0207693_100489453 95
109 3300025915 Ga0207693_10347361 Ga0207693_103473612 95
110 3300025933 Ga0207706_11195113 Ga0207706_111951131 95
111 3300026035 Ga0207703_10408952 Ga0207703_104089522 95
112 3300048903 Ga0496100_0763073 Ga0496100_0763073_81_368 95
113 3300048908 Ga0496105_0454082 Ga0496105_0454082_397_684 95
114 3300048909 Ga0496106_0872234 Ga0496106_0872234_81_368 95
115 3300048910 Ga0496107_0387810 Ga0496107_0387810_741_1028 95
116 3300048912 Ga0496109_0005413 Ga0496109_0005413_392_679 95
117 3300048915 Ga0496112_0022025 Ga0496112_0022025_1706_1993 95
118 3300048916 Ga0496113_0003628 Ga0496113_0003628_6639_6926 95
119 3300048918 Ga0496115_0149342 Ga0496115_0149342_630_917 95
120 3300050512 nmdc:mga0n895_752553_c1 nmdc:mga0n895_752553_c1_503_790 95
121 3300005290 Ga0065712_10108622 Ga0065712_101086221 96
122 3300005293 Ga0065715_10122029 Ga0065715_101220292 96
123 3300005293 Ga0065715_10204997 Ga0065715_102049971 96
124 3300005437 Ga0070710_10032258 Ga0070710_100322583 96
125 3300005439 Ga0070711_100159105 Ga0070711_1001591051 96
126 3300005439 Ga0070711_100202817 Ga0070711_1002028172 96
127 3300005445 Ga0070708_100509097 Ga0070708_1005090972 96
128 3300005456 Ga0070678_101797757 Ga0070678_1017977572 96
129 3300005468 Ga0070707_100129565 Ga0070707_1001295653 96
130 3300005468 Ga0070707_101018255 Ga0070707_1010182552 96
131 3300005471 Ga0070698_100386076 Ga0070698_1003860762 96
132 3300005536 Ga0070697_100124038 Ga0070697_1001240382 96
133 3300005536 Ga0070697_101424885 Ga0070697_1014248851 96
134 3300006028 Ga0070717_10450830 Ga0070717_104508302 96
135 3300006163 Ga0070715_10039048 Ga0070715_100390482 96
136 3300006175 Ga0070712_100339777 Ga0070712_1003397771 96
137 3300006844 Ga0075428_101309722 Ga0075428_1013097222 96
138 3300006852 Ga0075433_10634687 Ga0075433_106346871 96
139 3300009094 Ga0111539_10567343 Ga0111539_105673432 96
140 3300009147 Ga0114129_11575148 Ga0114129_115751481 96
141 3300009553 Ga0105249_10743390 Ga0105249_107433902 96
142 3300010375 Ga0105239_13548550 Ga0105239_135485501 96
143 3300013296 Ga0157374_10362356 Ga0157374_103623562 96
144 3300013308 Ga0157375_10306621 Ga0157375_103066213 96
145 3300025315 Ga0207697_10109571 Ga0207697_101095711 96
146 3300025915 Ga0207693_10085374 Ga0207693_100853741 96
147 3300025922 Ga0207646_10010612 Ga0207646_1001061210 96
148 3300025922 Ga0207646_10304421 Ga0207646_103044212 96
149 3300025928 Ga0207700_11243452 Ga0207700_112434522 96
150 3300025939 Ga0207665_10365862 Ga0207665_103658622 96
151 3300035116 Ga0373945_0057008 Ga0373945_0057008_411_707 96
152 3300035692 Ga0373935_0146839 Ga0373935_0146839_878_1174 96
153 3300035692 Ga0373935_0491426 Ga0373935_0491426_444_737 96
154 3300035695 Ga0373927_0218084 Ga0373927_0218084_645_941 96
155 3300035725 Ga0373947_0023098 Ga0373947_0023098_2587_2883 96
156 3300037068 Ga0373925_0041184 Ga0373925_0041184_3057_3353 96
157 3300050507 nmdc:mga05p37_1079072_c1 nmdc:mga05p37_1079072_c1_542_832 96
158 3300050511 nmdc:mga08y16_505440_c1 nmdc:mga08y16_505440_c1_369_659 96
159 3300050515 nmdc:mga0a205_131151_c1 nmdc:mga0a205_131151_c1_479_769 96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yn0-assembly1.cif.gz_B crystal structure of app e2 domain in complex with dr6 crd domain 0.918 24 91
5tpt-assembly1.cif.gz_B the crystal structure of amyloid precursor-like protein 2 (aplp2) e2 domain 0.914 22 95
7zcm-assembly1.cif.gz_B dark state structure of sensory rhodopsin ii in complex with htrii solved by room temperature serial synchrotron crystallography 0.8673 32 88
5izs-assembly1.cif.gz_A de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.8488 24 93
5izs-assembly1.cif.gz_B de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.8482 24 93
ID Description Score Start End Superfamily
3umkA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Amyloid precursor protein, E2 domain 0.9266 24 95 1.20.120.770
5tptB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Amyloid precursor protein, E2 domain 0.914 22 95 1.20.120.770
2fdcB03 Special;Helix non-globular;Helix Hairpins; 0.8957 36 78 6.10.140.240
af_Q5APE0_1_154_1.20.58.1250 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Tubulin Binding Cofactor C, N-terminal domain 0.8911 25 72 1.20.58.1250
1h2sB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.865 32 83 1.10.287.470
ID Description Score Start End GO Terms
AF-A0A838Q9V0-F1-model_v4 Uncharacterized protein 0.9843 16 93
AF-A0A3B8Q994-F1-model_v4 Uncharacterized protein 0.9738 22 89
AF-A0A314ZMH1-F1-model_v4 Uncharacterized protein 0.9678 25 95
AF-A0A3D0M955-F1-model_v4 UvrD-like helicase ATP-binding domain-containing protein 0.9603 25 90 GO:0000725
GO:0003677
GO:0005524
GO:0005829
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518
AF-A0A838Q9V0-F1-model_v4 Uncharacterized protein 0.9596 16 93

Feature Viewer

pLDDT pTM Quality
90.62 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map