F231281

General Info

Members Datasets Scaffolds Average Seq Length
159 133 318 157

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100066219|Ga0070670_1000662192
Length 191
Sequence LNNKKTKKASGGSRGAGKSDASSSAPTSGSPLDVRVLEQIVKLMSANDLNTIEVRDGDRRVILKRGADIVAPSASSGFYAPPAMSAPSPGLVSGAATSPSSTTSTPAVTDDANLIAVKSPMVGTFYSAPSPDAKPFVSVGSTVDEETDVCVIEAMKVFNNIKAECRGSIAKILVTNGQTVEFGQPLFLVKP

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
76 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
90 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
91 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
107 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
108 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
109 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
110 2671180694 Paenibacillus sp. A3 Isolate Unclassified
111 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
112 2738543017 Bacillus sp. OV186 Isolate Unclassified
113 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
114 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
115 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
116 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
117 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
118 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
119 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
120 2857586860 Bacillus sp. R-71935 Isolate Unclassified
121 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
122 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
123 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
124 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
125 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
126 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
127 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
128 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
129 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
130 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
131 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
132 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
133 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.5
Metatranscriptomes 2.52
Isolates 16.98

Biome Distribution

Category Percentage (%)
Aerial Root 1.26
Bulb 0
Endosphere 14.47
Nodule 0
Rhizoplane 2.52
Rhizosphere 70.44
Stem 0
Stem Tuber 0
Unclassified 5.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100066219 3300005331 Bacteria 3100
2 JGI25151J46595_10018631 3300003187 Bacteria 2973
3 JGI25151J46595_10026456 3300003187 Bacteria 2340
4 JGI25151J46595_10051782 3300003187 Bacteria 1387
5 Ga0055538_1000222 3300003751 Bacteria 32336
6 Ga0055538_1000362 3300003751 Bacteria 19131
7 Ga0055532_1000046 3300003758 Bacteria 182389
8 Ga0055536_1019527 3300003781 Bacteria 2126
9 Ga0055536_1042674 3300003781 Bacteria 1059
10 Ga0070676_10364341 3300005328 Unclassified 997
11 Ga0070670_100191002 3300005331 Bacteria 1779
12 Ga0068869_100383605 3300005334 Bacteria 1152
13 Ga0070666_10662258 3300005335 Unclassified 764
14 Ga0070689_100070048 3300005340 Bacteria 2737
15 Ga0070675_100030761 3300005354 Unclassified 4336
16 Ga0070675_100175025 3300005354 Bacteria 1853
17 Ga0070673_101094943 3300005364 Bacteria 744
18 Ga0070688_100001385 3300005365 Bacteria 12054
19 Ga0070714_100382134 3300005435 Bacteria 1328
20 Ga0070713_100166722 3300005436 Bacteria 1970
21 Ga0070700_100708778 3300005441 Bacteria 801
22 Ga0070685_10015828 3300005466 Bacteria 4010
23 Ga0070665_100001197 3300005548 Bacteria 31616
24 Ga0068857_100240300 3300005577 Bacteria 1658
25 Ga0068861_100612282 3300005719 Bacteria 1001
26 Ga0068863_100561871 3300005841 Bacteria 1127
27 Ga0068858_100522365 3300005842 Bacteria 1148
28 Ga0068860_100053717 3300005843 Unclassified 3830
29 Ga0068860_101256981 3300005843 Bacteria 761
30 Ga0081539_10013399 3300005985 Bacteria 6180
31 Ga0070717_11144770 3300006028 Bacteria 708
32 Ga0075428_101294197 3300006844 Bacteria 767
33 Ga0075431_100600384 3300006847 Unclassified 1085
34 Ga0075433_10424869 3300006852 Bacteria 1172
35 Ga0105244_10000751 3300009036 Bacteria 27721
36 Ga0105244_10048059 3300009036 Bacteria 2185
37 Ga0105240_10161698 3300009093 Bacteria 2659
38 Ga0111539_10760646 3300009094 Bacteria 1128
39 Ga0105245_10091875 3300009098 Bacteria 2794
40 Ga0105245_11269175 3300009098 Bacteria 785
41 Ga0114129_12535903 3300009147 Bacteria 612
42 Ga0105248_11346622 3300009177 Bacteria 808
43 Ga0105238_10113893 3300009551 Bacteria 2684
44 Ga0105246_10004499 3300011119 Bacteria 8476
45 Ga0157379_11029931 3300014968 Bacteria 786
46 Ga0209784_100046 3300025224 Bacteria 200009
47 Ga0209784_100146 3300025224 Bacteria 64806
48 Ga0209147_100014 3300025229 Bacteria 597841
49 Ga0209147_100139 3300025229 Bacteria 116694
50 Ga0209130_1011422 3300025284 Bacteria 2379
51 Ga0209675_1007160 3300025291 Bacteria 4325
52 Ga0209676_1000489 3300025292 Bacteria 63909
53 Ga0209676_1003078 3300025292 Bacteria 10753
54 Ga0209025_1001960 3300025294 Bacteria 23699
55 Ga0209025_1005654 3300025294 Bacteria 10071
56 Ga0209025_1006616 3300025294 Bacteria 8918
57 Ga0209025_1014851 3300025294 Bacteria 4748
58 Ga0209025_1035583 3300025294 Bacteria 2247
59 Ga0209025_1045623 3300025294 Bacteria 1814
60 Ga0209025_1093706 3300025294 Bacteria 973
61 Ga0207696_1013179 3300025711 Bacteria 2894
62 Ga0207655_1001747 3300025728 Bacteria 19069
63 Ga0207655_1038571 3300025728 Bacteria 2086
64 Ga0207680_10100560 3300025903 Unclassified 1857
65 Ga0207654_10259234 3300025911 Bacteria 1168
66 Ga0207707_10770829 3300025912 Bacteria 803
67 Ga0207695_10240861 3300025913 Bacteria 1710
68 Ga0207650_10334583 3300025925 Bacteria 1242
69 Ga0207659_10123486 3300025926 Bacteria 1987
70 Ga0207659_10170413 3300025926 Bacteria 1717
71 Ga0207700_10109378 3300025928 Bacteria 2221
72 Ga0207664_10256367 3300025929 Bacteria 1528
73 Ga0207644_10067567 3300025931 Bacteria 2606
74 Ga0207686_10270467 3300025934 Bacteria 1250
75 Ga0207689_10347911 3300025942 Bacteria 1232
76 Ga0207651_10936997 3300025960 Bacteria 772
77 Ga0207658_10048706 3300025986 Bacteria 3109
78 Ga0207703_10308329 3300026035 Bacteria 1446
79 Ga0207708_10991391 3300026075 Bacteria 730
80 Ga0207641_10547438 3300026088 Bacteria 1128
81 Ga0207674_10354601 3300026116 Bacteria 1418
82 Ga0268266_10001353 3300028379 Bacteria 29617
83 Ga0268264_10100706 3300028381 Bacteria 2510
84 Ga0265325_10088828 3300031241 Bacteria 1527
85 Ga0265340_10086306 3300031247 Bacteria 1472
86 Ga0265340_10086959 3300031247 Bacteria 1465
87 Ga0265316_10012580 3300031344 Bacteria 7580
88 Ga0265316_10110016 3300031344 Bacteria 2087
89 Ga0265316_10200875 3300031344 Bacteria 1478
90 Ga0265313_10047080 3300031595 Bacteria 2089
91 Ga0265314_10002561 3300031711 Bacteria 18463
92 Ga0265342_10143933 3300031712 Bacteria 1328
93 Ga0307410_10358831 3300031852 Bacteria 1167
94 Ga0307412_10482199 3300031911 Bacteria 1029
95 Ga0307409_100232181 3300031995 Bacteria 1673
96 Ga0307409_100342541 3300031995 Bacteria 1407
97 Ga0307416_101308151 3300032002 Bacteria 831
98 Ga0373933_0371277 3300035724 Bacteria 931
99 Ga0451807_0931028 3300041486 Bacteria 574
100 Ga0451835_1231614 3300041492 Unclassified 674
101 Ga0451576_0002329 3300045051 Bacteria 28728
102 Ga0495608_0225010 3300046511 Bacteria 1176
103 Ga0495618_0615910 3300046514 Bacteria 645
104 Ga0495628_0276212 3300046516 Bacteria 1249
105 Ga0495667_0575760 3300046559 Bacteria 702
106 Ga0495634_0236687 3300046642 Bacteria 1121
107 Ga0495657_0218923 3300046675 Bacteria 1155
108 Ga0495613_0003647 3300046689 Bacteria 11534
109 Ga0495674_0435447 3300047319 Bacteria 1055
110 Ga0495684_0002804 3300047471 Bacteria 13748
111 Ga0496103_0118415 3300048906 Bacteria 1686
112 Ga0496107_0511003 3300048910 Bacteria 891
113 Ga0496125_0010303 3300048928 Bacteria 9465
114 Ga0496126_0611059 3300048929 Bacteria 858
115 Ga0501307_043772 3300049162 Bacteria 657
116 Ga0501315_007788 3300049531 Bacteria 1229
117 Ga0501334_11870 3300049550 Bacteria 642
118 Ga0501338_04796 3300049554 Bacteria 826
119 Ga0501034_0000551 3300049571 Bacteria 59419
120 Ga0501034_0014069 3300049571 Bacteria 8243
121 Ga0501037_0042952 3300049573 Bacteria 3322
122 Ga0501040_0103900 3300049576 Bacteria 1984
123 Ga0501047_0041883 3300049581 Bacteria 4425
124 Ga0501070_0027587 3300049586 Bacteria 4763
125 Ga0501080_0012369 3300049742 Bacteria 7822
126 Ga0501080_0051551 3300049742 Bacteria 3829
127 Ga0501083_0120317 3300049744 Bacteria 1722
128 Ga0501044_0001383 3300049823 Bacteria 28449
129 nmdc:mga05p37_1709310_c1 3300050507 Bacteria 613
130 nmdc:mga06r32_637816_c1 3300050510 Unclassified 1034
131 nmdc:mga08y16_855386_c1 3300050511 Bacteria 898
132 nmdc:mga0a205_435545_c1 3300050515 Bacteria 1172
133 2512732421 2512564039 Bacteria 8739048
134 2595091592 2593339131 Bacteria 5116855
135 2595318533 2593339198 Bacteria 7267884
136 2673822816 2671180694 Bacteria 7506943
137 2712197702 2711768088 Bacteria 3195027
138 2739270312 2738543017 Bacteria 4271950
139 2757568039 2757320391 Bacteria 4746095
140 2777760957 2775507177 Bacteria 4384303
141 2777835856 2775507192 Bacteria 4622234
142 2791214241 2788500588 Bacteria 4584915
143 2819629162 2818991451 Bacteria 4697364
144 2857453687 2857453340 Bacteria 8090534
145 2857470249 2857465823 Bacteria 6772595
146 2857590507 2857586860 Bacteria 4354574
147 2857591629 2857591370 Bacteria 6569758
148 2888581062 2888578766 Bacteria 6743310
149 2904607978 2904606771 Bacteria 4684500
150 2919429807 2919425241 Bacteria 8055701
151 2936341318 2936340661 Bacteria 5139038
152 2939596898 2939593269 Bacteria 4798695
153 2971411078 2971410472 Bacteria 8311090
154 2980128983 2980125574 Bacteria 5567337
155 2984530174 2984527788 Bacteria 5288478
156 2984536281 2984532647 Bacteria 5288506
157 8055535205 8055531788 Bacteria 5249694
158 8056536379 8056533031 Bacteria 8964429
159 8057586629 8057582654 Bacteria 5218944
160 Ga0070670_100066219
161 JGI25151J46595_10018631
162 JGI25151J46595_10026456
163 JGI25151J46595_10051782
164 Ga0055538_1000222
165 Ga0055538_1000362
166 Ga0055532_1000046
167 Ga0055536_1019527
168 Ga0055536_1042674
169 Ga0070676_10364341
170 Ga0070670_100191002
171 Ga0068869_100383605
172 Ga0070666_10662258
173 Ga0070689_100070048
174 Ga0070675_100030761
175 Ga0070675_100175025
176 Ga0070673_101094943
177 Ga0070688_100001385
178 Ga0070714_100382134
179 Ga0070713_100166722
180 Ga0070700_100708778
181 Ga0070685_10015828
182 Ga0070665_100001197
183 Ga0068857_100240300
184 Ga0068861_100612282
185 Ga0068863_100561871
186 Ga0068858_100522365
187 Ga0068860_100053717
188 Ga0068860_101256981
189 Ga0081539_10013399
190 Ga0070717_11144770
191 Ga0075428_101294197
192 Ga0075431_100600384
193 Ga0075433_10424869
194 Ga0105244_10000751
195 Ga0105244_10048059
196 Ga0105240_10161698
197 Ga0111539_10760646
198 Ga0105245_10091875
199 Ga0105245_11269175
200 Ga0114129_12535903
201 Ga0105248_11346622
202 Ga0105238_10113893
203 Ga0105246_10004499
204 Ga0157379_11029931
205 Ga0209784_100046
206 Ga0209784_100146
207 Ga0209147_100014
208 Ga0209147_100139
209 Ga0209130_1011422
210 Ga0209675_1007160
211 Ga0209676_1000489
212 Ga0209676_1003078
213 Ga0209025_1001960
214 Ga0209025_1005654
215 Ga0209025_1006616
216 Ga0209025_1014851
217 Ga0209025_1035583
218 Ga0209025_1045623
219 Ga0209025_1093706
220 Ga0207696_1013179
221 Ga0207655_1001747
222 Ga0207655_1038571
223 Ga0207680_10100560
224 Ga0207654_10259234
225 Ga0207707_10770829
226 Ga0207695_10240861
227 Ga0207650_10334583
228 Ga0207659_10123486
229 Ga0207659_10170413
230 Ga0207700_10109378
231 Ga0207664_10256367
232 Ga0207644_10067567
233 Ga0207686_10270467
234 Ga0207689_10347911
235 Ga0207651_10936997
236 Ga0207658_10048706
237 Ga0207703_10308329
238 Ga0207708_10991391
239 Ga0207641_10547438
240 Ga0207674_10354601
241 Ga0268266_10001353
242 Ga0268264_10100706
243 Ga0265325_10088828
244 Ga0265340_10086306
245 Ga0265340_10086959
246 Ga0265316_10012580
247 Ga0265316_10110016
248 Ga0265316_10200875
249 Ga0265313_10047080
250 Ga0265314_10002561
251 Ga0265342_10143933
252 Ga0307410_10358831
253 Ga0307412_10482199
254 Ga0307409_100232181
255 Ga0307409_100342541
256 Ga0307416_101308151
257 Ga0373933_0371277
258 Ga0451807_0931028
259 Ga0451835_1231614
260 Ga0451576_0002329
261 Ga0495608_0225010
262 Ga0495618_0615910
263 Ga0495628_0276212
264 Ga0495667_0575760
265 Ga0495634_0236687
266 Ga0495657_0218923
267 Ga0495613_0003647
268 Ga0495674_0435447
269 Ga0495684_0002804
270 Ga0496103_0118415
271 Ga0496107_0511003
272 Ga0496125_0010303
273 Ga0496126_0611059
274 Ga0501307_043772
275 Ga0501315_007788
276 Ga0501334_11870
277 Ga0501338_04796
278 Ga0501034_0000551
279 Ga0501034_0014069
280 Ga0501037_0042952
281 Ga0501040_0103900
282 Ga0501047_0041883
283 Ga0501070_0027587
284 Ga0501080_0012369
285 Ga0501080_0051551
286 Ga0501083_0120317
287 Ga0501044_0001383
288 nmdc:mga05p37_1709310_c1
289 nmdc:mga06r32_637816_c1
290 nmdc:mga08y16_855386_c1
291 nmdc:mga0a205_435545_c1
292 2512732421
293 2595091592
294 2595318533
295 2673822816
296 2712197702
297 2739270312
298 2757568039
299 2777760957
300 2777835856
301 2791214241
302 2819629162
303 2857453687
304 2857470249
305 2857590507
306 2857591629
307 2888581062
308 2904607978
309 2919429807
310 2936341318
311 2939596898
312 2971411078
313 2980128983
314 2984530174
315 2984536281
316 8055535205
317 8056536379
318 8057586629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

115

189

0.97

Map