F226421

General Info

Members Datasets Scaffolds Average Seq Length
157 99 157 205

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100000589|Ga0070690_10000058913
Length 242
Sequence MSLAVPRVRLLCGARFRTNLHSNTRTPNQWSRVGRQAMSIWALVLILTAILALGGVFVWLALQVSAVRGPKRSEQDTLDGAAQDVEHIFNEEFREELRNRGRLHFEKILGENAMFLQQDLRLTTSQLNEYMKGEISRELKEAFLSYQGAIADAKQLAVESIERTKTAIDEERQSLVGQLEKEVAEEKARRIKQFEERMSEVINHYVLEAIGNQIDLGDQLEYILAEMEAHKAEILEDVRHGT

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
45 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
46 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
83 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
84 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
90 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
91 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
92 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
93 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
94 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
95 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
96 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
97 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
98 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
99 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.47
Nodule 0
Rhizoplane 0
Rhizosphere 79.62
Stem 0
Stem Tuber 0
Unclassified 1.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001114 3300001915 Bacteria 7972
2 JGI24737J22298_10000030 3300001990 Bacteria 42783
3 JGI24735J21928_10001133 3300002067 Bacteria 9527
4 JGI24742J22300_10000040 3300002244 Bacteria 19074
5 rootH2_10000244 3300003320 Bacteria 697651
6 rootH2_10273059 3300003320 Bacteria 1492
7 rootH1_10098214 3300003323 Bacteria 5355
8 JGI25405J52794_10008770 3300003911 Bacteria 1897
9 Ga0070658_10000447 3300005327 Bacteria 35694
10 Ga0070658_10006883 3300005327 Bacteria 9189
11 Ga0070658_10096584 3300005327 Bacteria 2440
12 Ga0070676_10008333 3300005328 Bacteria 5586
13 Ga0070683_100001186 3300005329 Bacteria 19786
14 Ga0070690_100000589 3300005330 Bacteria 18278
15 Ga0070680_100001550 3300005336 Bacteria 16785
16 Ga0070680_100019855 3300005336 Bacteria 5328
17 Ga0070682_100398433 3300005337 Bacteria 1040
18 Ga0070682_100511637 3300005337 Unclassified 932
19 Ga0070660_100000265 3300005339 Bacteria 34665
20 Ga0070660_100150378 3300005339 Bacteria 1872
21 Ga0070691_10004201 3300005341 Bacteria 6547
22 Ga0070659_100000287 3300005366 Bacteria 39394
23 Ga0070667_100000001 3300005367 Bacteria 1108638
24 Ga0070663_100324455 3300005455 Unclassified 1239
25 Ga0070681_10110269 3300005458 Bacteria 2691
26 Ga0070681_10216474 3300005458 Bacteria 1831
27 Ga0070679_100006339 3300005530 Bacteria 11015
28 Ga0070679_100009595 3300005530 Bacteria 9154
29 Ga0070679_100021090 3300005530 Bacteria 6358
30 Ga0070679_100453340 3300005530 Bacteria 1227
31 Ga0070679_100626383 3300005530 Bacteria 1019
32 Ga0070684_100003903 3300005535 Bacteria 11292
33 Ga0070686_100001809 3300005544 Bacteria 11926
34 Ga0070693_100010806 3300005547 Bacteria 4581
35 Ga0068855_100000001 3300005563 Bacteria 818777
36 Ga0068855_100000413 3300005563 Bacteria 52993
37 Ga0068855_100001300 3300005563 Bacteria 30928
38 Ga0068857_100000012 3300005577 Bacteria 106243
39 Ga0068857_100401857 3300005577 Unclassified 1275
40 Ga0068856_100004747 3300005614 Bacteria 13490
41 Ga0068856_100005199 3300005614 Bacteria 12849
42 Ga0068852_100249402 3300005616 Unclassified 1700
43 Ga0081455_10000008 3300005937 Bacteria 256558
44 Ga0075365_10058536 3300006038 Bacteria 2566
45 Ga0075365_10178062 3300006038 Bacteria 1486
46 Ga0075368_10000117 3300006042 Bacteria 20858
47 Ga0075364_10001042 3300006051 Bacteria 14758
48 Ga0075364_10252649 3300006051 Bacteria 1198
49 Ga0075367_10003989 3300006178 Bacteria 7130
50 Ga0075367_10243852 3300006178 Bacteria 1126
51 Ga0075366_10000132 3300006195 Bacteria 31135
52 Ga0075366_10000249 3300006195 Bacteria 23668
53 Ga0075366_10273285 3300006195 Bacteria 1032
54 Ga0075366_10416490 3300006195 Bacteria 827
55 Ga0097621_100000501 3300006237 Bacteria 27406
56 Ga0075370_10000347 3300006353 Bacteria 16789
57 Ga0068871_100044548 3300006358 Bacteria 3569
58 Ga0105240_10031460 3300009093 Bacteria 6882
59 Ga0105240_10740707 3300009093 Unclassified 1069
60 Ga0105245_10000044 3300009098 Bacteria 135878
61 Ga0105245_10068241 3300009098 Bacteria 3222
62 Ga0105245_10605268 3300009098 Unclassified 1123
63 Ga0114129_11508550 3300009147 Unclassified 826
64 Ga0105243_10025126 3300009148 Unclassified 4549
65 Ga0105241_10000003 3300009174 Bacteria 839043
66 Ga0105241_10000359 3300009174 Bacteria 34562
67 Ga0105241_10026358 3300009174 Unclassified 4324
68 Ga0105242_10088373 3300009176 Bacteria 2603
69 Ga0105238_10000350 3300009551 Bacteria 49662
70 Ga0105238_10912885 3300009551 Bacteria 897
71 Ga0105033_100338 3300009986 Bacteria 3664
72 Ga0105033_102298 3300009986 Bacteria 1583
73 Ga0105030_101036 3300009987 Bacteria 2478
74 Ga0105028_100455 3300009993 Unclassified 4382
75 Ga0157373_10000179 3300013100 Bacteria 52272
76 Ga0157373_10028210 3300013100 Bacteria 4050
77 Ga0157371_10000105 3300013102 Bacteria 126728
78 Ga0157370_10107414 3300013104 Bacteria 2610
79 Ga0157369_10000832 3300013105 Bacteria 39454
80 Ga0157369_10007066 3300013105 Bacteria 12948
81 Ga0157374_10000058 3300013296 Bacteria 116810
82 Ga0157372_10000090 3300013307 Bacteria 93559
83 Ga0157372_10010905 3300013307 Bacteria 9674
84 Ga0207647_10002818 3300025904 Bacteria 13115
85 Ga0207645_10006469 3300025907 Bacteria 8403
86 Ga0207705_10000011 3300025909 Bacteria 517768
87 Ga0207705_10002925 3300025909 Bacteria 13054
88 Ga0207705_10147104 3300025909 Bacteria 1763
89 Ga0207705_10525005 3300025909 Bacteria 920
90 Ga0207654_10000002 3300025911 Bacteria 1460142
91 Ga0207654_10005188 3300025911 Bacteria 6573
92 Ga0207654_10046280 3300025911 Bacteria 2480
93 Ga0207707_10274391 3300025912 Bacteria 1461
94 Ga0207707_10940336 3300025912 Bacteria 712
95 Ga0207695_10025161 3300025913 Bacteria 6674
96 Ga0207660_10002258 3300025917 Bacteria 12719
97 Ga0207660_10042841 3300025917 Bacteria 3179
98 Ga0207657_10000772 3300025919 Bacteria 33957
99 Ga0207657_10001705 3300025919 Bacteria 23697
100 Ga0207657_10030206 3300025919 Bacteria 4922
101 Ga0207652_10001769 3300025921 Bacteria 18828
102 Ga0207652_10008162 3300025921 Bacteria 8407
103 Ga0207652_10089944 3300025921 Bacteria 2697
104 Ga0207652_10653640 3300025921 Bacteria 940
105 Ga0207694_10001075 3300025924 Bacteria 23755
106 Ga0207694_10638352 3300025924 Bacteria 897
107 Ga0207687_10000033 3300025927 Bacteria 135886
108 Ga0207690_10000901 3300025932 Bacteria 18972
109 Ga0207686_10050597 3300025934 Bacteria 2584
110 Ga0207709_10031239 3300025935 Unclassified 3108
111 Ga0207661_10001571 3300025944 Bacteria 15543
112 Ga0207667_10000003 3300025949 Bacteria 822935
113 Ga0207667_10000060 3300025949 Bacteria 192320
114 Ga0207667_10000196 3300025949 Bacteria 88101
115 Ga0207668_10080427 3300025972 Unclassified 2361
116 Ga0207658_10000003 3300025986 Bacteria 1151934
117 Ga0207678_10237505 3300026067 Bacteria 1561
118 Ga0207702_10000001 3300026078 Bacteria 895738
119 Ga0207702_10004179 3300026078 Bacteria 12925
120 Ga0207702_10187013 3300026078 Unclassified 1911
121 Ga0207702_10351372 3300026078 Bacteria 1411
122 Ga0207702_10583528 3300026078 Bacteria 1096
123 Ga0207674_10000015 3300026116 Bacteria 183445
124 Ga0207698_10509138 3300026142 Unclassified 1173
125 Ga0209813_10000001 3300027866 Bacteria 280406
126 Ga0268265_10429713 3300028380 Bacteria 1228
127 Ga0265338_10012893 3300028800 Bacteria 9495
128 Ga0265338_10157528 3300028800 Unclassified 1757
129 Ga0265338_10247671 3300028800 Unclassified 1316
130 Ga0316177_1047646 3300030731 Bacteria 1150
131 Ga0265327_10000025 3300031251 Bacteria 380054
132 Ga0395899_0077313 3300037312 Unclassified 2427
133 Ga0395900_0000305 3300037418 Bacteria 73205
134 Ga0395900_0342432 3300037418 Bacteria 1470
135 Ga0495649_0000734 3300046694 Bacteria 26638
136 Ga0495600_0034248 3300046809 Viruses 3297
137 Ga0501037_0076982 3300049573 Bacteria 2421
138 Ga0501046_0174639 3300049580 Unclassified 1610
139 Ga0501070_0102986 3300049586 Unclassified 2361
140 Ga0501073_0152033 3300049589 Bacteria 1604
141 Ga0501080_0000114 3300049742 Bacteria 55765
142 nmdc:mga03683_49_c4 3300050489 Bacteria 19085
143 nmdc:mga03n38_57_c1 3300050490 Bacteria 23529
144 nmdc:mga00v17_3319_c1 3300050491 Bacteria 8298
145 nmdc:mga0yw44_410449_c1 3300050492 Unclassified 916
146 nmdc:mga0yw44_47300_c1 3300050492 Bacteria 2588
147 nmdc:mga0yw44_527619_c1 3300050492 Unclassified 801
148 nmdc:mga0k408_2356_c1 3300050493 Bacteria 10052
149 nmdc:mga0k408_392187_c1 3300050493 Bacteria 827
150 nmdc:mga0k408_46_c3 3300050493 Bacteria 36804
151 nmdc:mga06z11_12_c1 3300050494 Bacteria 100611
152 nmdc:mga06z11_213077_c1 3300050494 Bacteria 1126
153 nmdc:mga04h51_1_c1 3300050495 Bacteria 273320
154 nmdc:mga07m45_316_c1 3300050496 Bacteria 19475
155 Ga0500561_0000001 3300053137 Bacteria 957685
156 Ga0500603_011345 3300053150 Bacteria 2027
157 Ga0500604_0038103 3300053151 Bacteria 1441

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0077313 Ga0395899_0077313_209_829 179
2 3300037418 Ga0395900_0000305 Ga0395900_0000305_48783_49403 179
3 3300003323 rootH1_10098214 rootH1_100982143 184
4 3300026078 Ga0207702_10583528 Ga0207702_105835282 186
5 3300028800 Ga0265338_10247671 Ga0265338_102476711 189
6 3300005336 Ga0070680_100019855 Ga0070680_1000198555 193
7 3300005458 Ga0070681_10216474 Ga0070681_102164741 193
8 3300005530 Ga0070679_100009595 Ga0070679_1000095957 193
9 3300009176 Ga0105242_10088373 Ga0105242_100883733 193
10 3300025912 Ga0207707_10940336 Ga0207707_109403361 193
11 3300025917 Ga0207660_10042841 Ga0207660_100428413 193
12 3300025921 Ga0207652_10008162 Ga0207652_100081627 193
13 3300025934 Ga0207686_10050597 Ga0207686_100505973 193
14 3300009986 Ga0105033_100338 Ga0105033_1003382 194
15 3300037418 Ga0395900_0342432 Ga0395900_0342432_317_940 196
16 3300005327 Ga0070658_10096584 Ga0070658_100965841 198
17 3300005530 Ga0070679_100453340 Ga0070679_1004533402 198
18 3300009098 Ga0105245_10068241 Ga0105245_100682412 198
19 3300025909 Ga0207705_10525005 Ga0207705_105250052 198
20 3300025921 Ga0207652_10653640 Ga0207652_106536401 198
21 3300046809 Ga0495600_0034248 Ga0495600_0034248_1243_1869 198
22 3300006195 Ga0075366_10416490 Ga0075366_104164901 200
23 3300050493 nmdc:mga0k408_392187_c1 nmdc:mga0k408_392187_c1_59_676 200
24 3300005614 Ga0068856_100004747 Ga0068856_10000474712 202
25 3300026078 Ga0207702_10187013 Ga0207702_101870132 202
26 3300005327 Ga0070658_10000447 Ga0070658_1000044724 203
27 3300005336 Ga0070680_100001550 Ga0070680_1000015508 203
28 3300005339 Ga0070660_100150378 Ga0070660_1001503782 203
29 3300005367 Ga0070667_100000001 Ga0070667_100000001538 203
30 3300005458 Ga0070681_10110269 Ga0070681_101102693 203
31 3300005530 Ga0070679_100006339 Ga0070679_1000063396 203
32 3300009986 Ga0105033_102298 Ga0105033_1022983 203
33 3300013307 Ga0157372_10010905 Ga0157372_100109053 203
34 3300025909 Ga0207705_10002925 Ga0207705_1000292511 203
35 3300025912 Ga0207707_10274391 Ga0207707_102743911 203
36 3300025917 Ga0207660_10002258 Ga0207660_1000225815 203
37 3300025919 Ga0207657_10030206 Ga0207657_100302064 203
38 3300025921 Ga0207652_10001769 Ga0207652_100017693 203
39 3300025986 Ga0207658_10000003 Ga0207658_10000003842 203
40 3300005337 Ga0070682_100511637 Ga0070682_1005116372 204
41 3300006042 Ga0075368_10000117 Ga0075368_1000011711 204
42 3300006178 Ga0075367_10003989 Ga0075367_100039893 204
43 3300006353 Ga0075370_10000347 Ga0075370_100003475 204
44 3300009093 Ga0105240_10740707 Ga0105240_107407071 204
45 3300027866 Ga0209813_10000001 Ga0209813_10000001176 204
46 3300050490 nmdc:mga03n38_57_c1 nmdc:mga03n38_57_c1_15112_15726 204
47 3300050494 nmdc:mga06z11_12_c1 nmdc:mga06z11_12_c1_27000_27614 204
48 3300050495 nmdc:mga04h51_1_c1 nmdc:mga04h51_1_c1_156286_156900 204
49 3300050496 nmdc:mga07m45_316_c1 nmdc:mga07m45_316_c1_15511_16125 204
50 3300001915 JGI24741J21665_1001114 JGI24741J21665_10011149 205
51 3300001990 JGI24737J22298_10000030 JGI24737J22298_1000003026 205
52 3300002067 JGI24735J21928_10001133 JGI24735J21928_100011338 205
53 3300002244 JGI24742J22300_10000040 JGI24742J22300_100000407 205
54 3300003320 rootH2_10000244 rootH2_10000244632 205
55 3300003320 rootH2_10273059 rootH2_102730592 205
56 3300003911 JGI25405J52794_10008770 JGI25405J52794_100087701 205
57 3300005327 Ga0070658_10006883 Ga0070658_1000688310 205
58 3300005328 Ga0070676_10008333 Ga0070676_100083336 205
59 3300005329 Ga0070683_100001186 Ga0070683_10000118617 205
60 3300005330 Ga0070690_100000589 Ga0070690_10000058913 205
61 3300005337 Ga0070682_100398433 Ga0070682_1003984331 205
62 3300005339 Ga0070660_100000265 Ga0070660_10000026522 205
63 3300005341 Ga0070691_10004201 Ga0070691_100042016 205
64 3300005366 Ga0070659_100000287 Ga0070659_1000002872 205
65 3300005455 Ga0070663_100324455 Ga0070663_1003244552 205
66 3300005530 Ga0070679_100021090 Ga0070679_1000210905 205
67 3300005530 Ga0070679_100626383 Ga0070679_1006263832 205
68 3300005535 Ga0070684_100003903 Ga0070684_1000039033 205
69 3300005544 Ga0070686_100001809 Ga0070686_1000018093 205
70 3300005547 Ga0070693_100010806 Ga0070693_1000108065 205
71 3300005563 Ga0068855_100000001 Ga0068855_100000001149 205
72 3300005563 Ga0068855_100000413 Ga0068855_10000041319 205
73 3300005563 Ga0068855_100001300 Ga0068855_10000130021 205
74 3300005577 Ga0068857_100000012 Ga0068857_1000000125 205
75 3300005577 Ga0068857_100401857 Ga0068857_1004018572 205
76 3300005614 Ga0068856_100005199 Ga0068856_1000051999 205
77 3300005616 Ga0068852_100249402 Ga0068852_1002494022 205
78 3300005937 Ga0081455_10000008 Ga0081455_1000000885 205
79 3300006038 Ga0075365_10058536 Ga0075365_100585363 205
80 3300006038 Ga0075365_10178062 Ga0075365_101780622 205
81 3300006051 Ga0075364_10001042 Ga0075364_100010425 205
82 3300006051 Ga0075364_10252649 Ga0075364_102526492 205
83 3300006178 Ga0075367_10243852 Ga0075367_102438522 205
84 3300006195 Ga0075366_10000132 Ga0075366_1000013225 205
85 3300006195 Ga0075366_10000249 Ga0075366_1000024928 205
86 3300006195 Ga0075366_10273285 Ga0075366_102732852 205
87 3300006237 Ga0097621_100000501 Ga0097621_1000005019 205
88 3300006358 Ga0068871_100044548 Ga0068871_1000445482 205
89 3300009093 Ga0105240_10031460 Ga0105240_100314607 205
90 3300009098 Ga0105245_10000044 Ga0105245_1000004473 205
91 3300009098 Ga0105245_10605268 Ga0105245_106052682 205
92 3300009147 Ga0114129_11508550 Ga0114129_115085501 205
93 3300009148 Ga0105243_10025126 Ga0105243_100251262 205
94 3300009174 Ga0105241_10000003 Ga0105241_10000003440 205
95 3300009174 Ga0105241_10000359 Ga0105241_100003599 205
96 3300009174 Ga0105241_10026358 Ga0105241_100263585 205
97 3300009551 Ga0105238_10000350 Ga0105238_1000035011 205
98 3300009551 Ga0105238_10912885 Ga0105238_109128852 205
99 3300009987 Ga0105030_101036 Ga0105030_1010363 205
100 3300009993 Ga0105028_100455 Ga0105028_1004554 205
101 3300013100 Ga0157373_10000179 Ga0157373_1000017938 205
102 3300013100 Ga0157373_10028210 Ga0157373_100282102 205
103 3300013102 Ga0157371_10000105 Ga0157371_1000010568 205
104 3300013104 Ga0157370_10107414 Ga0157370_101074143 205
105 3300013105 Ga0157369_10000832 Ga0157369_100008323 205
106 3300013105 Ga0157369_10007066 Ga0157369_100070661 205
107 3300013296 Ga0157374_10000058 Ga0157374_1000005848 205
108 3300013307 Ga0157372_10000090 Ga0157372_1000009066 205
109 3300025904 Ga0207647_10002818 Ga0207647_100028189 205
110 3300025907 Ga0207645_10006469 Ga0207645_100064693 205
111 3300025909 Ga0207705_10000011 Ga0207705_1000001187 205
112 3300025909 Ga0207705_10147104 Ga0207705_101471042 205
113 3300025911 Ga0207654_10000002 Ga0207654_10000002766 205
114 3300025911 Ga0207654_10005188 Ga0207654_100051886 205
115 3300025911 Ga0207654_10046280 Ga0207654_100462803 205
116 3300025913 Ga0207695_10025161 Ga0207695_100251617 205
117 3300025919 Ga0207657_10000772 Ga0207657_100007723 205
118 3300025919 Ga0207657_10001705 Ga0207657_1000170511 205
119 3300025921 Ga0207652_10089944 Ga0207652_100899443 205
120 3300025924 Ga0207694_10001075 Ga0207694_100010754 205
121 3300025924 Ga0207694_10638352 Ga0207694_106383522 205
122 3300025927 Ga0207687_10000033 Ga0207687_1000003372 205
123 3300025932 Ga0207690_10000901 Ga0207690_100009012 205
124 3300025935 Ga0207709_10031239 Ga0207709_100312392 205
125 3300025944 Ga0207661_10001571 Ga0207661_1000157110 205
126 3300025949 Ga0207667_10000003 Ga0207667_10000003143 205
127 3300025949 Ga0207667_10000060 Ga0207667_1000006039 205
128 3300025949 Ga0207667_10000196 Ga0207667_1000019661 205
129 3300025972 Ga0207668_10080427 Ga0207668_100804273 205
130 3300026067 Ga0207678_10237505 Ga0207678_102375052 205
131 3300026078 Ga0207702_10000001 Ga0207702_10000001473 205
132 3300026078 Ga0207702_10004179 Ga0207702_100041799 205
133 3300026078 Ga0207702_10351372 Ga0207702_103513722 205
134 3300026116 Ga0207674_10000015 Ga0207674_1000001528 205
135 3300026142 Ga0207698_10509138 Ga0207698_105091382 205
136 3300028380 Ga0268265_10429713 Ga0268265_104297132 205
137 3300028800 Ga0265338_10012893 Ga0265338_100128935 205
138 3300028800 Ga0265338_10157528 Ga0265338_101575281 205
139 3300030731 Ga0316177_1047646 Ga0316177_10476462 205
140 3300031251 Ga0265327_10000025 Ga0265327_10000025344 205
141 3300046694 Ga0495649_0000734 Ga0495649_0000734_13749_14366 205
142 3300049573 Ga0501037_0076982 Ga0501037_0076982_868_1488 205
143 3300049580 Ga0501046_0174639 Ga0501046_0174639_521_1141 205
144 3300049586 Ga0501070_0102986 Ga0501070_0102986_267_896 205
145 3300049589 Ga0501073_0152033 Ga0501073_0152033_164_784 205
146 3300049742 Ga0501080_0000114 Ga0501080_0000114_24608_25228 205
147 3300050489 nmdc:mga03683_49_c4 nmdc:mga03683_49_c4_15370_15993 205
148 3300050491 nmdc:mga00v17_3319_c1 nmdc:mga00v17_3319_c1_3031_3648 205
149 3300050492 nmdc:mga0yw44_410449_c1 nmdc:mga0yw44_410449_c1_99_725 205
150 3300050492 nmdc:mga0yw44_47300_c1 nmdc:mga0yw44_47300_c1_737_1354 205
151 3300050492 nmdc:mga0yw44_527619_c1 nmdc:mga0yw44_527619_c1_94_714 205
152 3300050493 nmdc:mga0k408_2356_c1 nmdc:mga0k408_2356_c1_1215_1832 205
153 3300050493 nmdc:mga0k408_46_c3 nmdc:mga0k408_46_c3_16322_16939 205
154 3300050494 nmdc:mga06z11_213077_c1 nmdc:mga06z11_213077_c1_93_710 205
155 3300053137 Ga0500561_0000001 Ga0500561_0000001_819269_819886 205
156 3300053150 Ga0500603_011345 Ga0500603_011345_610_1227 205
157 3300053151 Ga0500604_0038103 Ga0500604_0038103_173_799 205

Feature Viewer

pLDDT pTM Quality
82.37 0.34 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map