F222172

General Info

Members Datasets Scaffolds Average Seq Length
155 99 310 338

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10222124|Ga0105242_102221241
Length 382
Sequence VTVDLSPYLDAVPDLVVERLRGARHVLAVGHENPDADTLGASLAIVHLVRALGGTADPVTSDPPPPLYDFLTGVDRVMTDPDPSADYDLVVISDCGSLERVGAVGVRHADLFARVPRIVIDHHASNQVDGDADWVDPRAAATCEMVTLLALRLGIPLDIDGGAMATALMGGIVMDTATFAHPNATPRTLAVSAALVEAGAPLSDISRRLYRTKPDAQLRLFGLVLGRMQSSDDGRIVWSTLADADLAATGTQPPHSEGIIDLLAQSDEAEVAILFKEAGEGMPARPGPRWRCPWPRPCPPCSPRRSVSSPPSGADDGPQVARPRPGRDPGGRQARGSHLARRGRPGAASRRDAGPVRLGRPAGLPRPRDAGRGAVQRTGAHP

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
56 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
65 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
66 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
67 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
68 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
69 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
70 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
71 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
72 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
73 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
76 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
77 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
78 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
79 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
89 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
92 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
93 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
94 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
95 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
96 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
97 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
98 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
99 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 20
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 9.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10222124 3300009176 Bacteria 1689
2 Ga0070683_100169626 3300005329 Bacteria 2071
3 Ga0070680_100000036 3300005336 Bacteria 67394
4 Ga0068868_100192817 3300005338 Unclassified 1695
5 Ga0070674_100032450 3300005356 Bacteria 3468
6 Ga0070705_100095955 3300005440 Bacteria 1860
7 Ga0070700_100229133 3300005441 Bacteria 1321
8 Ga0070708_100007442 3300005445 Bacteria 8763
9 Ga0070708_100041150 3300005445 Bacteria 4051
10 Ga0070708_100065906 3300005445 Bacteria 3249
11 Ga0070708_100122076 3300005445 Unclassified 2404
12 Ga0070708_100124513 3300005445 Bacteria 2381
13 Ga0070706_100012154 3300005467 Bacteria 7981
14 Ga0070706_100023518 3300005467 Bacteria 5675
15 Ga0070707_100010144 3300005468 Bacteria 8768
16 Ga0070707_100017601 3300005468 Bacteria 6722
17 Ga0070707_100050575 3300005468 Bacteria 3984
18 Ga0070707_100213634 3300005468 Bacteria 1880
19 Ga0070698_100245809 3300005471 Bacteria 1722
20 Ga0070699_100012712 3300005518 Bacteria 7255
21 Ga0070699_100015605 3300005518 Bacteria 6524
22 Ga0070684_100148199 3300005535 Bacteria 2125
23 Ga0070697_100028460 3300005536 Bacteria 4474
24 Ga0070697_100148838 3300005536 Bacteria 1972
25 Ga0070695_100029351 3300005545 Bacteria 3417
26 Ga0070695_100051831 3300005545 Bacteria 2634
27 Ga0070696_100007351 3300005546 Bacteria 7355
28 Ga0070696_100067438 3300005546 Bacteria 2511
29 Ga0070696_100320569 3300005546 Bacteria 1192
30 Ga0070693_100062334 3300005547 Bacteria 2170
31 Ga0070704_100163229 3300005549 Bacteria 1764
32 Ga0070664_100138488 3300005564 Bacteria 2141
33 Ga0068854_100095545 3300005578 Bacteria 2219
34 Ga0070702_100163808 3300005615 Bacteria 1440
35 Ga0068864_100081114 3300005618 Bacteria 2843
36 Ga0068861_100097531 3300005719 Bacteria 2332
37 Ga0068860_100224557 3300005843 Bacteria 1824
38 Ga0081539_10005916 3300005985 Bacteria 12085
39 Ga0081539_10082536 3300005985 Unclassified 1685
40 Ga0075428_100001251 3300006844 Bacteria 27177
41 Ga0075433_10038270 3300006852 Bacteria 4141
42 Ga0075434_100050563 3300006871 Bacteria 4129
43 Ga0075436_100075203 3300006914 Bacteria 2339
44 Ga0075435_100273454 3300007076 Bacteria 1441
45 Ga0105245_10027305 3300009098 Bacteria 5030
46 Ga0105245_10036259 3300009098 Bacteria 4380
47 Ga0105245_10078119 3300009098 Bacteria 3020
48 Ga0105245_10510988 3300009098 Bacteria 1219
49 Ga0114129_10010558 3300009147 Bacteria 13170
50 Ga0114129_10067524 3300009147 Bacteria 4987
51 Ga0105243_10119517 3300009148 Bacteria 2219
52 Ga0105242_10247020 3300009176 Bacteria 1606
53 Ga0105248_10290296 3300009177 Bacteria 1842
54 Ga0105249_10429425 3300009553 Bacteria 1356
55 Ga0105239_10161639 3300010375 Bacteria 2502
56 Ga0105246_10003452 3300011119 Bacteria 9584
57 Ga0157378_10139958 3300013297 Bacteria 2246
58 Ga0157375_10183951 3300013308 Bacteria 2242
59 Ga0157375_10272074 3300013308 Bacteria 1856
60 Ga0163163_10047527 3300014325 Bacteria 4219
61 Ga0163163_10096357 3300014325 Bacteria 2978
62 Ga0163163_10342546 3300014325 Bacteria 1550
63 Ga0207645_10062851 3300025907 Bacteria 2372
64 Ga0207684_10008485 3300025910 Bacteria 9139
65 Ga0207684_10021305 3300025910 Bacteria 5534
66 Ga0207684_10054887 3300025910 Bacteria 3380
67 Ga0207684_10098799 3300025910 Bacteria 2493
68 Ga0207684_10121624 3300025910 Bacteria 2238
69 Ga0207707_10097632 3300025912 Bacteria 2568
70 Ga0207660_10000001 3300025917 Bacteria 1034169
71 Ga0207646_10047090 3300025922 Bacteria 3868
72 Ga0207646_10047687 3300025922 Bacteria 3842
73 Ga0207646_10164709 3300025922 Bacteria 2001
74 Ga0207646_10199879 3300025922 Bacteria 1805
75 Ga0207687_10066205 3300025927 Bacteria 2568
76 Ga0207687_10104562 3300025927 Bacteria 2090
77 Ga0207706_10242475 3300025933 Bacteria 1576
78 Ga0207709_10070267 3300025935 Bacteria 2220
79 Ga0207711_10216692 3300025941 Bacteria 1750
80 Ga0207689_10126859 3300025942 Bacteria 2099
81 Ga0207708_10095838 3300026075 Bacteria 2292
82 Ga0207641_10364776 3300026088 Bacteria 1380
83 Ga0207648_10323913 3300026089 Bacteria 1385
84 Ga0207675_100137076 3300026118 Unclassified 2323
85 Ga0265329_10005341 3300031242 Bacteria 5204
86 Ga0316575_10073018 3300031665 Unclassified 1380
87 Ga0265342_10026634 3300031712 Bacteria 3619
88 Ga0316576_10005654 3300031727 Bacteria 7680
89 Ga0316583_10014455 3300032133 Bacteria 2845
90 Ga0373947_0119095 3300035725 Bacteria 1676
91 Ga0439466_0016527 3300041411 Bacteria 2666
92 Ga0451577_0021635 3300042876 Bacteria 5882
93 Ga0451576_0468895 3300045051 Unclassified 1322
94 Ga0495586_0117678 3300046535 Bacteria 1483
95 Ga0495635_0182500 3300046663 Bacteria 1426
96 Ga0495635_0268913 3300046663 Unclassified 1147
97 Ga0496101_0026677 3300048904 Bacteria 4018
98 Ga0496102_0024355 3300048905 Bacteria 5381
99 Ga0496102_0265518 3300048905 Bacteria 1618
100 Ga0496103_0082823 3300048906 Unclassified 2019
101 Ga0496104_0028768 3300048907 Bacteria 5150
102 Ga0496104_0048128 3300048907 Bacteria 4020
103 Ga0496105_0000468 3300048908 Bacteria 26573
104 Ga0496105_0038840 3300048908 Bacteria 3922
105 Ga0496107_0055802 3300048910 Bacteria 2853
106 Ga0496108_0003060 3300048911 Bacteria 13440
107 Ga0496108_0022998 3300048911 Bacteria 5128
108 Ga0496108_0052640 3300048911 Bacteria 3412
109 Ga0496108_0198938 3300048911 Bacteria 1739
110 Ga0496109_0034251 3300048912 Bacteria 4572
111 Ga0496109_0092699 3300048912 Bacteria 2794
112 Ga0496109_0099948 3300048912 Bacteria 2691
113 Ga0496109_0299618 3300048912 Bacteria 1516
114 Ga0496110_0022232 3300048913 Bacteria 5382
115 Ga0496110_0031864 3300048913 Bacteria 4550
116 Ga0496110_0247682 3300048913 Bacteria 1622
117 Ga0496111_0003711 3300048914 Bacteria 9498
118 Ga0496111_0032560 3300048914 Bacteria 3717
119 Ga0496111_0070592 3300048914 Unclassified 2541
120 Ga0496111_0142050 3300048914 Bacteria 1779
121 Ga0496112_0000010 3300048915 Bacteria 245046
122 Ga0496112_0070294 3300048915 Bacteria 3459
123 Ga0496112_0178347 3300048915 Bacteria 2088
124 Ga0496112_0293131 3300048915 Bacteria 1573
125 Ga0496113_0149846 3300048916 Bacteria 1839
126 Ga0496114_0024902 3300048917 Bacteria 4886
127 Ga0496114_0041861 3300048917 Bacteria 3796
128 Ga0501031_0020590 3300049568 Bacteria 4301
129 Ga0501038_0056764 3300049574 Bacteria 3363
130 Ga0501040_0011170 3300049576 Bacteria 5873
131 Ga0501040_0110838 3300049576 Unclassified 1919
132 Ga0501041_0301467 3300049577 Bacteria 1010
133 Ga0501042_0057409 3300049578 Bacteria 2778
134 Ga0501071_0057237 3300049587 Bacteria 2817
135 Ga0501072_0085248 3300049588 Bacteria 2505
136 Ga0501072_0228003 3300049588 Bacteria 1484
137 Ga0501075_0002931 3300049591 Bacteria 11443
138 Ga0501075_0077207 3300049591 Bacteria 2520
139 Ga0501076_0015510 3300049592 Bacteria 5761
140 Ga0501076_0098451 3300049592 Unclassified 2356
141 Ga0501079_0032982 3300049741 Unclassified 3983
142 Ga0501079_0122070 3300049741 Bacteria 2026
143 Ga0501079_0122078 3300049741 Bacteria 2026
144 Ga0501079_0363980 3300049741 Unclassified 1133
145 Ga0501081_0248901 3300049743 Unclassified 1297
146 Ga0501035_0213359 3300049822 Bacteria 1651
147 Ga0501045_0005350 3300049824 Bacteria 8894
148 nmdc:mga05p37_624_c1 3300050507 Bacteria 39170
149 nmdc:mga0a205_11735_c1 3300050515 Bacteria 8081
150 Ga0495601_0173202 3300053077 Bacteria 1411
151 Ga0495612_0011439 3300053078 Bacteria 3579
152 Ga0495595_0069717 3300053084 Bacteria 1660
153 Ga0590075_007706 3300059424 Bacteria 2564
154 Ga0501082_0028031 3300060353 Bacteria 4851
155 Ga0530510_0019758 3300061734 Bacteria 4786
156 Ga0105242_10222124
157 Ga0070683_100169626
158 Ga0070680_100000036
159 Ga0068868_100192817
160 Ga0070674_100032450
161 Ga0070705_100095955
162 Ga0070700_100229133
163 Ga0070708_100007442
164 Ga0070708_100041150
165 Ga0070708_100065906
166 Ga0070708_100122076
167 Ga0070708_100124513
168 Ga0070706_100012154
169 Ga0070706_100023518
170 Ga0070707_100010144
171 Ga0070707_100017601
172 Ga0070707_100050575
173 Ga0070707_100213634
174 Ga0070698_100245809
175 Ga0070699_100012712
176 Ga0070699_100015605
177 Ga0070684_100148199
178 Ga0070697_100028460
179 Ga0070697_100148838
180 Ga0070695_100029351
181 Ga0070695_100051831
182 Ga0070696_100007351
183 Ga0070696_100067438
184 Ga0070696_100320569
185 Ga0070693_100062334
186 Ga0070704_100163229
187 Ga0070664_100138488
188 Ga0068854_100095545
189 Ga0070702_100163808
190 Ga0068864_100081114
191 Ga0068861_100097531
192 Ga0068860_100224557
193 Ga0081539_10005916
194 Ga0081539_10082536
195 Ga0075428_100001251
196 Ga0075433_10038270
197 Ga0075434_100050563
198 Ga0075436_100075203
199 Ga0075435_100273454
200 Ga0105245_10027305
201 Ga0105245_10036259
202 Ga0105245_10078119
203 Ga0105245_10510988
204 Ga0114129_10010558
205 Ga0114129_10067524
206 Ga0105243_10119517
207 Ga0105242_10247020
208 Ga0105248_10290296
209 Ga0105249_10429425
210 Ga0105239_10161639
211 Ga0105246_10003452
212 Ga0157378_10139958
213 Ga0157375_10183951
214 Ga0157375_10272074
215 Ga0163163_10047527
216 Ga0163163_10096357
217 Ga0163163_10342546
218 Ga0207645_10062851
219 Ga0207684_10008485
220 Ga0207684_10021305
221 Ga0207684_10054887
222 Ga0207684_10098799
223 Ga0207684_10121624
224 Ga0207707_10097632
225 Ga0207660_10000001
226 Ga0207646_10047090
227 Ga0207646_10047687
228 Ga0207646_10164709
229 Ga0207646_10199879
230 Ga0207687_10066205
231 Ga0207687_10104562
232 Ga0207706_10242475
233 Ga0207709_10070267
234 Ga0207711_10216692
235 Ga0207689_10126859
236 Ga0207708_10095838
237 Ga0207641_10364776
238 Ga0207648_10323913
239 Ga0207675_100137076
240 Ga0265329_10005341
241 Ga0316575_10073018
242 Ga0265342_10026634
243 Ga0316576_10005654
244 Ga0316583_10014455
245 Ga0373947_0119095
246 Ga0439466_0016527
247 Ga0451577_0021635
248 Ga0451576_0468895
249 Ga0495586_0117678
250 Ga0495635_0182500
251 Ga0495635_0268913
252 Ga0496101_0026677
253 Ga0496102_0024355
254 Ga0496102_0265518
255 Ga0496103_0082823
256 Ga0496104_0028768
257 Ga0496104_0048128
258 Ga0496105_0000468
259 Ga0496105_0038840
260 Ga0496107_0055802
261 Ga0496108_0003060
262 Ga0496108_0022998
263 Ga0496108_0052640
264 Ga0496108_0198938
265 Ga0496109_0034251
266 Ga0496109_0092699
267 Ga0496109_0099948
268 Ga0496109_0299618
269 Ga0496110_0022232
270 Ga0496110_0031864
271 Ga0496110_0247682
272 Ga0496111_0003711
273 Ga0496111_0032560
274 Ga0496111_0070592
275 Ga0496111_0142050
276 Ga0496112_0000010
277 Ga0496112_0070294
278 Ga0496112_0178347
279 Ga0496112_0293131
280 Ga0496113_0149846
281 Ga0496114_0024902
282 Ga0496114_0041861
283 Ga0501031_0020590
284 Ga0501038_0056764
285 Ga0501040_0011170
286 Ga0501040_0110838
287 Ga0501041_0301467
288 Ga0501042_0057409
289 Ga0501071_0057237
290 Ga0501072_0085248
291 Ga0501072_0228003
292 Ga0501075_0002931
293 Ga0501075_0077207
294 Ga0501076_0015510
295 Ga0501076_0098451
296 Ga0501079_0032982
297 Ga0501079_0122070
298 Ga0501079_0122078
299 Ga0501079_0363980
300 Ga0501081_0248901
301 Ga0501035_0213359
302 Ga0501045_0005350
303 nmdc:mga05p37_624_c1
304 nmdc:mga0a205_11735_c1
305 Ga0495601_0173202
306 Ga0495612_0011439
307 Ga0495595_0069717
308 Ga0590075_007706
309 Ga0501082_0028031
310 Ga0530510_0019758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01368

DHH

DHH family

25

172

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o25-assembly1.cif.gz_A structure of wildtype t.maritima pde (tm1595) in ligand-free state 0.9413 15 331
5o4z-assembly1.cif.gz_A structure of the inactive t.maritima pde (tm1595) d80n d154n mutant with substrate 5'-papa 0.933 15 331
5o25-assembly1.cif.gz_A structure of wildtype t.maritima pde (tm1595) in ligand-free state 0.9101 15 331
5o4z-assembly1.cif.gz_A structure of the inactive t.maritima pde (tm1595) d80n d154n mutant with substrate 5'-papa 0.8916 15 331
5jju-assembly1.cif.gz_B crystal structure of rv2837c complexed with 5'-papa and 5'-amp 0.8731 14 335
ID Description Score Start End Superfamily
4ls9B01 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) 0.9084 15 207 3.90.1640.10
af_A0A1D6HFN8_137_214_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8972 270 314 3.10.310.30
5ippA02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8953 219 333 3.10.310.30
af_Q2FXM3_201_313_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8757 219 332 3.10.310.30
5ippA02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8665 219 333 3.10.310.30
ID Description Score Start End GO Terms
AF-A0A1V5JR62-F1-model_v4 Bifunctional oligoribonuclease and PAP phosphatase NrnA (EC 3.1.-.-) 0.9674 215 332 GO:0003676
GO:0016787
AF-A0A536G5W9-F1-model_v4 DHHA1 domain-containing protein 0.9661 211 335 GO:0003676
AF-A0A7V3RRX3-F1-model_v4 Bifunctional oligoribonuclease/PAP phosphatase NrnA 0.9608 208 334 GO:0003676
AF-A0A7C3L2X4-F1-model_v4 Bifunctional oligoribonuclease/PAP phosphatase NrnA 0.9489 209 333 GO:0003676
AF-X1L3T3-F1-model_v4 DHHA1 domain-containing protein 0.9468 208 336 GO:0003676

Map