F220471

General Info

Members Datasets Scaffolds Average Seq Length
154 123 308 385

Family's Representative Sequence

Representative Sequence 3300046648|Ga0495611_0002278|Ga0495611_0002278_7408_8736
Length 442
Sequence MALKNRWETFVDSVSKTRHATNGGTSRRALLHGIAGFAITAGTAIVGTRQAAAEGAGIELPPATAEIVPFKIAIPEVALDDLKQRLGRARWPDRETVTDWSQGVPLAKIRALVDYWRDGYSWRRIEQTLNGFPQFRTQIDGLGIHFIHVRSKHENAMPIVLTHGWPGSMIEFLKIIDPLTNPTDHGGQPEDAFHVVLPSLPGFGFSDKPIDATWKVPRIAKAWATLMQRLGYSRWVAQGGDWGAGVTTALGHIKPAGLAGIHLNWQFVFPEKIPSEGLSVEEKRAVDAAAAFLANGYGYFLEQATRPQTVGYALADSPVGQAAWIYEKFQAWTDNDGDVENVLTKDAMLDDITLYWLTNTAASSARIYWDNYPESFVGGRIDLPVGASIFPKEIYRAPRSWAERDYPQLIHWNELPKGGHFAAFEQPGLFVGELRTCFAKLR

Samples

Sample ID Description Type Environment
1 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
53 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
63 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
64 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
65 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
66 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
67 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
68 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
69 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
70 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
71 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
72 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
73 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
74 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
75 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
76 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
77 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
78 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
79 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
80 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
81 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
84 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
85 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
86 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
87 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
88 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
89 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
90 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
91 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
95 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
105 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
106 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
107 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
108 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
109 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
110 2619618881 Frankia sp. ACN1ag Isolate Unclassified
111 2619619003 Frankia sp. CpI1-P Isolate Nodule
112 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
113 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
114 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
115 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
116 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
117 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
118 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
119 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
120 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
121 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
122 8054920844 Frankia tisae Agncl-8 Isolate Nodule
123 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.61
Metatranscriptomes 0
Isolates 10.39

Biome Distribution

Category Percentage (%)
Aerial Root 0.65
Bulb 0
Endosphere 3.9
Nodule 2.6
Rhizoplane 1.3
Rhizosphere 79.87
Stem 0
Stem Tuber 0
Unclassified 3.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495611_0002278 3300046648 Bacteria 8885
2 SwRhRL2b_contig_1906196 2162886007 Bacteria 5120
3 rootH1_10116660 3300003316 Bacteria 5772
4 rootH2_10161668 3300003320 Bacteria 5183
5 rootH2_10260168 3300003320 Bacteria 1627
6 rootL2_10012891 3300003322 Unclassified 1762
7 rootL2_10057277 3300003322 Bacteria 9498
8 Ga0065704_10001399 3300005289 Bacteria 18828
9 Ga0070683_100011134 3300005329 Bacteria 7759
10 Ga0070666_10009633 3300005335 Bacteria 6029
11 Ga0070668_100000089 3300005347 Bacteria 56897
12 Ga0070667_100000081 3300005367 Bacteria 118819
13 Ga0070667_100014587 3300005367 Bacteria 6495
14 Ga0070709_10221022 3300005434 Unclassified 1351
15 Ga0070706_100016663 3300005467 Bacteria 6788
16 Ga0070706_100140454 3300005467 Unclassified 2255
17 Ga0070698_100105704 3300005471 Bacteria 2784
18 Ga0070699_100041453 3300005518 Bacteria 3985
19 Ga0070699_100211760 3300005518 Bacteria 1725
20 Ga0070684_100248890 3300005535 Bacteria 1624
21 Ga0068853_100226194 3300005539 Bacteria 1710
22 Ga0070665_100000018 3300005548 Bacteria 434118
23 Ga0070665_100001015 3300005548 Bacteria 35290
24 Ga0068855_100000304 3300005563 Bacteria 61250
25 Ga0068859_100116535 3300005617 Bacteria 2736
26 Ga0068863_100000099 3300005841 Bacteria 94076
27 Ga0068863_100041389 3300005841 Bacteria 4381
28 Ga0068863_100089720 3300005841 Bacteria 2915
29 Ga0068860_100000328 3300005843 Bacteria 64568
30 Ga0068860_100013133 3300005843 Bacteria 8126
31 Ga0068862_100003601 3300005844 Bacteria 13263
32 Ga0070716_100046984 3300006173 Bacteria 2433
33 Ga0070712_100027885 3300006175 Bacteria 3773
34 Ga0075362_10043623 3300006177 Bacteria 1986
35 Ga0097620_100116533 3300006931 Bacteria 2736
36 Ga0105251_10001828 3300009011 Bacteria 17541
37 Ga0105240_10001887 3300009093 Bacteria 34847
38 Ga0105249_10079177 3300009553 Bacteria 3050
39 Ga0105239_10033691 3300010375 Bacteria 5624
40 Ga0157373_10001651 3300013100 Bacteria 17027
41 Ga0157371_10034812 3300013102 Bacteria 3611
42 Ga0163162_10000735 3300013306 Bacteria 30396
43 Ga0163162_10008446 3300013306 Bacteria 10046
44 Ga0157380_10181526 3300014326 Bacteria 1849
45 Ga0213875_10000982 3300021388 Bacteria 20411
46 Ga0207680_10156144 3300025903 Bacteria 1526
47 Ga0207684_10011601 3300025910 Bacteria 7700
48 Ga0207695_10000248 3300025913 Bacteria 140288
49 Ga0207671_10007058 3300025914 Bacteria 9834
50 Ga0207693_10101480 3300025915 Bacteria 2256
51 Ga0207646_10151279 3300025922 Bacteria 2093
52 Ga0207665_10008490 3300025939 Bacteria 6763
53 Ga0207661_10009870 3300025944 Bacteria 6858
54 Ga0207667_10001219 3300025949 Bacteria 32210
55 Ga0207668_10000005 3300025972 Bacteria 193572
56 Ga0207668_10000051 3300025972 Bacteria 98624
57 Ga0207640_10023781 3300025981 Bacteria 3687
58 Ga0207658_10000062 3300025986 Bacteria 118845
59 Ga0207658_10004179 3300025986 Bacteria 10062
60 Ga0207641_10000014 3300026088 Bacteria 336170
61 Ga0207641_10086995 3300026088 Bacteria 2726
62 Ga0207641_10127371 3300026088 Bacteria 2281
63 Ga0207674_10197545 3300026116 Bacteria 1961
64 Ga0268266_10000026 3300028379 Bacteria 434485
65 Ga0268266_10000889 3300028379 Bacteria 38692
66 Ga0268264_10002011 3300028381 Bacteria 18273
67 Ga0268264_10006310 3300028381 Bacteria 10000
68 Ga0265332_10008865 3300031238 Bacteria 4502
69 Ga0307509_10005509 3300031507 Bacteria 17579
70 Ga0307408_100029784 3300031548 Bacteria 3785
71 Ga0307405_10011797 3300031731 Bacteria 4600
72 Ga0307407_10015172 3300031903 Bacteria 3798
73 Ga0307412_10061264 3300031911 Bacteria 2529
74 Ga0307416_100043616 3300032002 Bacteria 3513
75 Ga0307415_100108080 3300032126 Bacteria 2057
76 Ga0307507_10008374 3300033179 Bacteria 14346
77 Ga0307510_10116331 3300033180 Bacteria 2395
78 Ga0373935_0005521 3300035692 Bacteria 7449
79 Ga0436364_0346005 3300037853 Bacteria 31597
80 Ga0451791_1045346 3300041451 Bacteria 3115
81 Ga0451837_1716154 3300041494 Bacteria 1395
82 Ga0466967_0176944 3300045976 Bacteria 2010
83 Ga0495638_0000016 3300046460 Bacteria 396505
84 Ga0495650_0000057 3300046471 Bacteria 303569
85 Ga0495650_0001660 3300046471 Bacteria 20561
86 Ga0495584_0000066 3300046491 Bacteria 75173
87 Ga0495585_0006146 3300046492 Bacteria 7492
88 Ga0495583_0002328 3300046506 Bacteria 16525
89 Ga0495583_0009088 3300046506 Bacteria 5976
90 Ga0495606_0000012 3300046507 Bacteria 294304
91 Ga0495606_0023808 3300046507 Bacteria 4428
92 Ga0495620_0001264 3300046515 Bacteria 15433
93 Ga0495620_0004175 3300046515 Bacteria 8179
94 Ga0495632_0000001 3300046519 Bacteria 873295
95 Ga0495632_0002040 3300046519 Bacteria 15900
96 Ga0495637_0000085 3300046520 Bacteria 72965
97 Ga0495643_0000020 3300046522 Bacteria 294973
98 Ga0495648_0000013 3300046524 Bacteria 289090
99 Ga0495648_0002339 3300046524 Bacteria 17604
100 Ga0495648_0012365 3300046524 Bacteria 6376
101 Ga0495663_0000002 3300046525 Bacteria 495384
102 Ga0495642_0002321 3300046528 Bacteria 7761
103 Ga0495597_0001117 3300046542 Bacteria 20288
104 Ga0495597_0008831 3300046542 Bacteria 5027
105 Ga0495597_0008995 3300046542 Bacteria 4973
106 Ga0495597_0053344 3300046542 Unclassified 1778
107 Ga0495633_0000376 3300046558 Bacteria 47585
108 Ga0495625_0000648 3300046660 Bacteria 50041
109 Ga0495661_0001158 3300046665 Bacteria 23006
110 Ga0495669_0089389 3300046684 Bacteria 1421
111 Ga0495670_0025467 3300046691 Bacteria 2926
112 Ga0495671_0000016 3300046692 Bacteria 294821
113 Ga0495671_0000018 3300046692 Bacteria 291470
114 Ga0495589_0000033 3300046794 Bacteria 162794
115 Ga0495660_0009802 3300046810 Bacteria 5579
116 Ga0495660_0023162 3300046810 Bacteria 3544
117 Ga0495687_000058 3300047443 Bacteria 185830
118 Ga0495687_000136 3300047443 Bacteria 113298
119 Ga0495673_0000130 3300047469 Bacteria 138192
120 Ga0495681_0015756 3300047470 Bacteria 4268
121 Ga0495686_0000005 3300047472 Bacteria 827143
122 Ga0495686_0008423 3300047472 Bacteria 7566
123 Ga0496115_0174231 3300048918 Bacteria 1779
124 Ga0496125_0001815 3300048928 Bacteria 29483
125 Ga0495678_000216 3300049459 Bacteria 66661
126 Ga0501031_0036784 3300049568 Bacteria 3194
127 Ga0501034_0027402 3300049571 Bacteria 5795
128 Ga0501047_0013773 3300049581 Bacteria 7681
129 Ga0501070_0001607 3300049586 Bacteria 20050
130 Ga0501249_000039 3300049679 Bacteria 58314
131 Ga0501035_0014702 3300049822 Bacteria 7225
132 Ga0501044_0042050 3300049823 Bacteria 4756
133 nmdc:mga0a205_432144_c1 3300050515 Bacteria 1178
134 Ga0500583_0000229 3300053092 Bacteria 20441
135 Ga0500583_0013399 3300053092 Bacteria 3170
136 Ga0500642_0013362 3300053130 Unclassified 3015
137 Ga0500622_0004487 3300053156 Bacteria 8746
138 Ga0500624_003189 3300053157 Bacteria 2159
139 2512350770 2512047030 Bacteria 9031815
140 2579858126 2579778521 Bacteria 7624758
141 2619857256 2619618881 Bacteria 7521104
142 2620353927 2619619003 Bacteria 7619552
143 2729909638 2728369276 Bacteria 5610032
144 2731907064 2731639228 Bacteria 4187555
145 2753302399 2751185788 Bacteria 4541048
146 2857483187 2857481737 Bacteria 4761446
147 2857579166 2857576091 Bacteria 5465855
148 2883825841 2883821847 Bacteria 5121194
149 2902685098 2902682994 Bacteria 8951596
150 2919043720 2919042368 Bacteria 3905917
151 2984553941 2984551494 Bacteria 3877562
152 8054918801 8054913762 Bacteria 7713009
153 8054927146 8054920844 Bacteria 7068637
154 8056040717 8056037122 Bacteria 3854319
155 Ga0495611_0002278
156 SwRhRL2b_contig_1906196
157 rootH1_10116660
158 rootH2_10161668
159 rootH2_10260168
160 rootL2_10012891
161 rootL2_10057277
162 Ga0065704_10001399
163 Ga0070683_100011134
164 Ga0070666_10009633
165 Ga0070668_100000089
166 Ga0070667_100000081
167 Ga0070667_100014587
168 Ga0070709_10221022
169 Ga0070706_100016663
170 Ga0070706_100140454
171 Ga0070698_100105704
172 Ga0070699_100041453
173 Ga0070699_100211760
174 Ga0070684_100248890
175 Ga0068853_100226194
176 Ga0070665_100000018
177 Ga0070665_100001015
178 Ga0068855_100000304
179 Ga0068859_100116535
180 Ga0068863_100000099
181 Ga0068863_100041389
182 Ga0068863_100089720
183 Ga0068860_100000328
184 Ga0068860_100013133
185 Ga0068862_100003601
186 Ga0070716_100046984
187 Ga0070712_100027885
188 Ga0075362_10043623
189 Ga0097620_100116533
190 Ga0105251_10001828
191 Ga0105240_10001887
192 Ga0105249_10079177
193 Ga0105239_10033691
194 Ga0157373_10001651
195 Ga0157371_10034812
196 Ga0163162_10000735
197 Ga0163162_10008446
198 Ga0157380_10181526
199 Ga0213875_10000982
200 Ga0207680_10156144
201 Ga0207684_10011601
202 Ga0207695_10000248
203 Ga0207671_10007058
204 Ga0207693_10101480
205 Ga0207646_10151279
206 Ga0207665_10008490
207 Ga0207661_10009870
208 Ga0207667_10001219
209 Ga0207668_10000005
210 Ga0207668_10000051
211 Ga0207640_10023781
212 Ga0207658_10000062
213 Ga0207658_10004179
214 Ga0207641_10000014
215 Ga0207641_10086995
216 Ga0207641_10127371
217 Ga0207674_10197545
218 Ga0268266_10000026
219 Ga0268266_10000889
220 Ga0268264_10002011
221 Ga0268264_10006310
222 Ga0265332_10008865
223 Ga0307509_10005509
224 Ga0307408_100029784
225 Ga0307405_10011797
226 Ga0307407_10015172
227 Ga0307412_10061264
228 Ga0307416_100043616
229 Ga0307415_100108080
230 Ga0307507_10008374
231 Ga0307510_10116331
232 Ga0373935_0005521
233 Ga0436364_0346005
234 Ga0451791_1045346
235 Ga0451837_1716154
236 Ga0466967_0176944
237 Ga0495638_0000016
238 Ga0495650_0000057
239 Ga0495650_0001660
240 Ga0495584_0000066
241 Ga0495585_0006146
242 Ga0495583_0002328
243 Ga0495583_0009088
244 Ga0495606_0000012
245 Ga0495606_0023808
246 Ga0495620_0001264
247 Ga0495620_0004175
248 Ga0495632_0000001
249 Ga0495632_0002040
250 Ga0495637_0000085
251 Ga0495643_0000020
252 Ga0495648_0000013
253 Ga0495648_0002339
254 Ga0495648_0012365
255 Ga0495663_0000002
256 Ga0495642_0002321
257 Ga0495597_0001117
258 Ga0495597_0008831
259 Ga0495597_0008995
260 Ga0495597_0053344
261 Ga0495633_0000376
262 Ga0495625_0000648
263 Ga0495661_0001158
264 Ga0495669_0089389
265 Ga0495670_0025467
266 Ga0495671_0000016
267 Ga0495671_0000018
268 Ga0495589_0000033
269 Ga0495660_0009802
270 Ga0495660_0023162
271 Ga0495687_000058
272 Ga0495687_000136
273 Ga0495673_0000130
274 Ga0495681_0015756
275 Ga0495686_0000005
276 Ga0495686_0008423
277 Ga0496115_0174231
278 Ga0496125_0001815
279 Ga0495678_000216
280 Ga0501031_0036784
281 Ga0501034_0027402
282 Ga0501047_0013773
283 Ga0501070_0001607
284 Ga0501249_000039
285 Ga0501035_0014702
286 Ga0501044_0042050
287 nmdc:mga0a205_432144_c1
288 Ga0500583_0000229
289 Ga0500583_0013399
290 Ga0500642_0013362
291 Ga0500622_0004487
292 Ga0500624_003189
293 2512350770
294 2579858126
295 2619857256
296 2620353927
297 2729909638
298 2731907064
299 2753302399
300 2857483187
301 2857579166
302 2883825841
303 2902685098
304 2919043720
305 2984553941
306 8054918801
307 8054927146
308 8056040717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06441

EHN

Epoxide hydrolase N terminus

67

172

0.97

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

157

296

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f4z-assembly3.cif.gz_E the crystal structure of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus 0.9567 16 391
4qa9-assembly1.cif.gz_A ensemble refinement of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus. 0.9481 14 390
5f4z-assembly3.cif.gz_E the crystal structure of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus 0.9254 16 391
4qa9-assembly1.cif.gz_A ensemble refinement of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus. 0.9195 14 390
4qla-assembly1.cif.gz_A crystal structure of juvenile hormone epoxide hydrolase from the silkworm bombyx mori 0.9092 15 391
ID Description Score Start End Superfamily
4qa9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9481 14 390 3.40.50.1820
4qa9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9195 14 390 3.40.50.1820
af_Q7JRC3_35_470_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9149 15 390 3.40.50.1820
4qlaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9092 15 391 3.40.50.1820
af_Q9D379_48_454_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9068 16 388 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7W6DJ29-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9892 15 391 GO:0004301
GO:0009056
GO:0097176
AF-A0A259GWF6-F1-model_v4 Epoxide hydrolase 0.9886 14 304 GO:0004301
GO:0009056
GO:0097176
AF-A0A1W7MFW4-F1-model_v4 Epoxide hydrolase (EC 3.3.2.9) 0.9844 15 391 GO:0009056
GO:0033961
GO:0097176
AF-A0A837B4R7-F1-model_v4 deleted 0.9797 68 278
AF-W1S399-F1-model_v4 Epoxide hydrolase 0.9794 15 391 GO:0004301
GO:0009056
GO:0097176

Map