F205342

General Info

Members Datasets Scaffolds Average Seq Length
149 106 149 88

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100503448|Ga0070708_1005034482
Length 102
Sequence VAYAVEFLKTAEQELVRLPKDAQRQIVKRVEGLKDNPRPPGVEPLKGAEKLLRLRVGDHRVVYTVESRHLVVLVVRIGHRKEVYEKLNVLASRVLIWKQRKK

Samples

Sample ID Description Type Environment
1 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
49 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
52 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
57 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
58 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
67 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
76 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
84 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
85 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
89 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
90 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
91 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
92 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
102 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
103 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
104 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
105 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
106 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.36
Nodule 0
Rhizoplane 3.36
Rhizosphere 92.62
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJN_F7QKVOU01EBMOY 2088090003 Unclassified 503
2 Ga0065715_10558824 3300005293 Bacteria 730
3 Ga0070670_100227156 3300005331 Bacteria 1624
4 Ga0070677_10235613 3300005333 Bacteria 901
5 Ga0070677_10336371 3300005333 Bacteria 778
6 Ga0070689_101652019 3300005340 Unclassified 582
7 Ga0070668_100476088 3300005347 Bacteria 1078
8 Ga0070673_101727878 3300005364 Bacteria 592
9 Ga0070708_100503448 3300005445 Bacteria 1142
10 Ga0070678_100356759 3300005456 Bacteria 1259
11 Ga0070707_100130591 3300005468 Bacteria 2443
12 Ga0070707_101054847 3300005468 Unclassified 778
13 Ga0070672_100831759 3300005543 Bacteria 813
14 Ga0070695_101672375 3300005545 Unclassified 532
15 Ga0068854_102167098 3300005578 Unclassified 514
16 Ga0070702_101865354 3300005615 Unclassified 503
17 Ga0068858_100676722 3300005842 Bacteria 1003
18 Ga0070717_11008447 3300006028 Unclassified 758
19 Ga0097621_101295877 3300006237 Unclassified 688
20 Ga0068871_100680389 3300006358 Unclassified 941
21 Ga0075433_10194484 3300006852 Bacteria 1804
22 Ga0105240_12422906 3300009093 Unclassified 543
23 Ga0111539_12204929 3300009094 Unclassified 639
24 Ga0105242_10819278 3300009176 Bacteria 923
25 Ga0105249_10001720 3300009553 Bacteria 19150
26 Ga0105239_10065811 3300010375 Bacteria 3981
27 Ga0105239_10772292 3300010375 Bacteria 1100
28 Ga0105246_10699513 3300011119 Unclassified 888
29 Ga0157369_12473675 3300013105 Unclassified 526
30 Ga0157378_10232573 3300013297 Bacteria 1757
31 Ga0163162_10877933 3300013306 Unclassified 1011
32 Ga0163162_11799380 3300013306 Bacteria 700
33 Ga0157372_11042228 3300013307 Bacteria 947
34 Ga0157375_12244572 3300013308 Unclassified 650
35 Ga0157375_13514026 3300013308 Unclassified 522
36 Ga0157380_10634504 3300014326 Unclassified 1063
37 Ga0157380_11392553 3300014326 Unclassified 751
38 Ga0157379_10734276 3300014968 Unclassified 929
39 Ga0157376_10154799 3300014969 Bacteria 2071
40 Ga0157376_12425957 3300014969 Bacteria 564
41 Ga0163161_10321563 3300017792 Unclassified 1223
42 Ga0207663_11324948 3300025916 Unclassified 580
43 Ga0207646_10104224 3300025922 Bacteria 2544
44 Ga0207659_10210483 3300025926 Unclassified 1558
45 Ga0207686_10581131 3300025934 Bacteria 879
46 Ga0207651_11480801 3300025960 Bacteria 611
47 Ga0207712_10075432 3300025961 Bacteria 2438
48 Ga0207703_11798078 3300026035 Bacteria 589
49 Ga0207683_10304118 3300026121 Bacteria 1459
50 Ga0265326_10003279 3300028558 Bacteria 5334
51 Ga0265334_10068919 3300028573 Bacteria 1320
52 Ga0265334_10272047 3300028573 Bacteria 582
53 Ga0265323_10003604 3300028653 Bacteria 6797
54 Ga0265323_10005481 3300028653 Bacteria 5391
55 Ga0265322_10097314 3300028654 Bacteria 837
56 Ga0265338_10032532 3300028800 Bacteria 5083
57 Ga0265324_10006907 3300029957 Bacteria 4675
58 Ga0265330_10023573 3300031235 Bacteria 2795
59 Ga0265330_10050120 3300031235 Bacteria 1831
60 Ga0265330_10186024 3300031235 Bacteria 879
61 Ga0265330_10259081 3300031235 Unclassified 733
62 Ga0265330_10388315 3300031235 Unclassified 590
63 Ga0265332_10039552 3300031238 Bacteria 2043
64 Ga0265332_10084251 3300031238 Bacteria 1347
65 Ga0265325_10098826 3300031241 Bacteria 1431
66 Ga0265329_10000965 3300031242 Bacteria 14448
67 Ga0265329_10003098 3300031242 Bacteria 7356
68 Ga0265329_10006446 3300031242 Bacteria 4654
69 Ga0265340_10532507 3300031247 Unclassified 517
70 Ga0265339_10004596 3300031249 Bacteria 9395
71 Ga0265339_10056753 3300031249 Bacteria 2119
72 Ga0265339_10231164 3300031249 Unclassified 901
73 Ga0265339_10372957 3300031249 Bacteria 670
74 Ga0265316_10001125 3300031344 Bacteria 28987
75 Ga0265316_10004505 3300031344 Bacteria 13846
76 Ga0265316_10017734 3300031344 Bacteria 6141
77 Ga0265316_10021643 3300031344 Bacteria 5439
78 Ga0265316_10149297 3300031344 Unclassified 1751
79 Ga0265316_10158700 3300031344 Bacteria 1691
80 Ga0265316_10782929 3300031344 Bacteria 669
81 Ga0265316_11171300 3300031344 Bacteria 532
82 Ga0265313_10019827 3300031595 Plasmid 3730
83 Ga0265314_10003533 3300031711 Bacteria 15099
84 Ga0265314_10107380 3300031711 Bacteria 1781
85 Ga0265342_10002071 3300031712 Bacteria 17780
86 Ga0265342_10005204 3300031712 Bacteria 9991
87 Ga0265342_10248175 3300031712 Bacteria 951
88 Ga0265342_10403606 3300031712 Unclassified 705
89 Ga0307413_10536176 3300031824 Unclassified 946
90 Ga0307410_10192853 3300031852 Bacteria 1550
91 Ga0307410_10255760 3300031852 Bacteria 1364
92 Ga0307406_10079623 3300031901 Bacteria 2173
93 Ga0307406_10715498 3300031901 Bacteria 837
94 Ga0307407_10109506 3300031903 Bacteria 1731
95 Ga0307407_10374664 3300031903 Bacteria 1015
96 Ga0307409_100013113 3300031995 Bacteria 5317
97 Ga0307409_100184378 3300031995 Bacteria 1851
98 Ga0307409_100297197 3300031995 Bacteria 1500
99 Ga0307416_100474793 3300032002 Bacteria 1309
100 Ga0307411_10057463 3300032005 Bacteria 2570
101 Ga0307411_10292975 3300032005 Bacteria 1301
102 Ga0373954_0561031 3300035118 Bacteria 566
103 Ga0373956_0248094 3300035119 Bacteria 846
104 Ga0373935_0484752 3300035692 Bacteria 896
105 Ga0373937_0801963 3300036401 Bacteria 889
106 Ga0316584_0931009 3300036712 Unclassified 584
107 Ga0373925_0549738 3300037068 Bacteria 949
108 Ga0373925_0619372 3300037068 Bacteria 892
109 Ga0395899_0302312 3300037312 Bacteria 1082
110 Ga0395900_0227283 3300037418 Unclassified 1878
111 Ga0395905_0000013 3300037471 Bacteria 400797
112 Ga0400486_25919 3300038742 Unclassified 2167
113 Ga0451807_1220150 3300041486 Unclassified 523
114 Ga0451807_1493929 3300041486 Bacteria 1631
115 Ga0451577_1522854 3300042876 Bacteria 591
116 Ga0439440_0074881 3300042993 Unclassified 887
117 Ga0453683_0000569 3300044673 Bacteria 40862
118 Ga0453683_0002471 3300044673 Bacteria 14294
119 Ga0453683_1214361 3300044673 Unclassified 505
120 Ga0451576_0495765 3300045051 Bacteria 1283
121 Ga0495664_0058616 3300046477 Bacteria 2291
122 Ga0495630_1133239 3300046517 Bacteria 592
123 Ga0495663_0010712 3300046525 Bacteria 2551
124 Ga0495621_0006068 3300046539 Bacteria 3510
125 Ga0495633_0248417 3300046558 Bacteria 812
126 Ga0495658_0428555 3300046683 Bacteria 844
127 Ga0495613_0245972 3300046689 Bacteria 1249
128 Ga0495613_0576174 3300046689 Unclassified 751
129 Ga0495670_0015964 3300046691 Bacteria 3691
130 Ga0495636_0258356 3300047318 Bacteria 807
131 Ga0495677_0179846 3300047445 Plasmid 819
132 Ga0495684_0599540 3300047471 Bacteria 743
133 Ga0496101_0091096 3300048904 Bacteria 2269
134 Ga0496104_0040256 3300048907 Bacteria 4380
135 Ga0496114_0006585 3300048917 Bacteria 9159
136 Ga0501032_0000147 3300049569 Bacteria 57366
137 Ga0501036_0396709 3300049572 Bacteria 1151
138 Ga0501037_0586176 3300049573 Unclassified 750
139 Ga0501038_0143612 3300049574 Bacteria 1950
140 Ga0501039_0174706 3300049575 Unclassified 1689
141 Ga0501039_1321608 3300049575 Unclassified 556
142 Ga0501047_0231803 3300049581 Bacteria 1700
143 Ga0501075_0550255 3300049591 Bacteria 881
144 Ga0501242_009258 3300049674 Bacteria 1164
145 Ga0500651_0000191 3300053093 Bacteria 39269
146 Ga0500651_0030593 3300053093 Bacteria 3388
147 Ga0500641_0035438 3300053096 Bacteria 1991
148 Ga0500614_003042 3300053123 Bacteria 3645
149 Ga0500577_0000302 3300053142 Bacteria 12795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100130591 Ga0070707_1001305913 71
2 3300025922 Ga0207646_10104224 Ga0207646_101042244 71
3 3300005331 Ga0070670_100227156 Ga0070670_1002271563 84
4 3300005333 Ga0070677_10336371 Ga0070677_103363712 84
5 3300005340 Ga0070689_101652019 Ga0070689_1016520192 84
6 3300005364 Ga0070673_101727878 Ga0070673_1017278782 84
7 3300005456 Ga0070678_100356759 Ga0070678_1003567592 84
8 3300005543 Ga0070672_100831759 Ga0070672_1008317592 84
9 3300005545 Ga0070695_101672375 Ga0070695_1016723752 84
10 3300005578 Ga0068854_102167098 Ga0068854_1021670982 84
11 3300006237 Ga0097621_101295877 Ga0097621_1012958772 84
12 3300006358 Ga0068871_100680389 Ga0068871_1006803893 84
13 3300009094 Ga0111539_12204929 Ga0111539_122049291 84
14 3300009176 Ga0105242_10819278 Ga0105242_108192783 84
15 3300013297 Ga0157378_10232573 Ga0157378_102325733 84
16 3300013307 Ga0157372_11042228 Ga0157372_110422282 84
17 3300013308 Ga0157375_12244572 Ga0157375_122445722 84
18 3300014326 Ga0157380_10634504 Ga0157380_106345041 84
19 3300014968 Ga0157379_10734276 Ga0157379_107342763 84
20 3300014969 Ga0157376_10154799 Ga0157376_101547993 84
21 3300014969 Ga0157376_12425957 Ga0157376_124259572 84
22 3300025916 Ga0207663_11324948 Ga0207663_113249482 84
23 3300025926 Ga0207659_10210483 Ga0207659_102104833 84
24 3300025934 Ga0207686_10581131 Ga0207686_105811312 84
25 3300025960 Ga0207651_11480801 Ga0207651_114808012 84
26 3300026121 Ga0207683_10304118 Ga0207683_103041182 84
27 3300028558 Ga0265326_10003279 Ga0265326_100032793 84
28 3300028573 Ga0265334_10068919 Ga0265334_100689192 84
29 3300028573 Ga0265334_10272047 Ga0265334_102720472 84
30 3300028653 Ga0265323_10003604 Ga0265323_100036048 84
31 3300028654 Ga0265322_10097314 Ga0265322_100973141 84
32 3300028800 Ga0265338_10032532 Ga0265338_100325323 84
33 3300031235 Ga0265330_10023573 Ga0265330_100235735 84
34 3300031235 Ga0265330_10050120 Ga0265330_100501203 84
35 3300031235 Ga0265330_10186024 Ga0265330_101860242 84
36 3300031235 Ga0265330_10259081 Ga0265330_102590811 84
37 3300031241 Ga0265325_10098826 Ga0265325_100988262 84
38 3300031242 Ga0265329_10000965 Ga0265329_100009653 84
39 3300031242 Ga0265329_10006446 Ga0265329_100064467 84
40 3300031249 Ga0265339_10056753 Ga0265339_100567534 84
41 3300031249 Ga0265339_10231164 Ga0265339_102311641 84
42 3300031344 Ga0265316_10004505 Ga0265316_100045052 84
43 3300031344 Ga0265316_10017734 Ga0265316_100177348 84
44 3300031344 Ga0265316_10021643 Ga0265316_100216436 84
45 3300031344 Ga0265316_10149297 Ga0265316_101492974 84
46 3300031344 Ga0265316_10158700 Ga0265316_101587002 84
47 3300031344 Ga0265316_10782929 Ga0265316_107829293 84
48 3300031344 Ga0265316_11171300 Ga0265316_111713002 84
49 3300031595 Ga0265313_10019827 Ga0265313_100198274 84
50 3300031711 Ga0265314_10003533 Ga0265314_1000353312 84
51 3300031712 Ga0265342_10005204 Ga0265342_100052043 84
52 3300031712 Ga0265342_10403606 Ga0265342_104036062 84
53 3300031824 Ga0307413_10536176 Ga0307413_105361762 84
54 3300031852 Ga0307410_10192853 Ga0307410_101928533 84
55 3300031852 Ga0307410_10255760 Ga0307410_102557603 84
56 3300031901 Ga0307406_10079623 Ga0307406_100796233 84
57 3300031901 Ga0307406_10715498 Ga0307406_107154981 84
58 3300031903 Ga0307407_10109506 Ga0307407_101095063 84
59 3300031903 Ga0307407_10374664 Ga0307407_103746643 84
60 3300031995 Ga0307409_100013113 Ga0307409_1000131132 84
61 3300031995 Ga0307409_100184378 Ga0307409_1001843783 84
62 3300031995 Ga0307409_100297197 Ga0307409_1002971972 84
63 3300032002 Ga0307416_100474793 Ga0307416_1004747932 84
64 3300032005 Ga0307411_10057463 Ga0307411_100574634 84
65 3300032005 Ga0307411_10292975 Ga0307411_102929752 84
66 3300035118 Ga0373954_0561031 Ga0373954_0561031_263_532 84
67 3300035119 Ga0373956_0248094 Ga0373956_0248094_481_750 84
68 3300036401 Ga0373937_0801963 Ga0373937_0801963_601_870 84
69 3300037068 Ga0373925_0619372 Ga0373925_0619372_266_535 84
70 3300037418 Ga0395900_0227283 Ga0395900_0227283_115_372 84
71 3300037471 Ga0395905_0000013 Ga0395905_0000013_382724_382981 84
72 3300038742 Ga0400486_25919 Ga0400486_25919_1120_1413 84
73 3300041486 Ga0451807_1220150 Ga0451807_1220150_13_276 84
74 3300041486 Ga0451807_1493929 Ga0451807_1493929_533_796 84
75 3300044673 Ga0453683_0000569 Ga0453683_0000569_33140_33397 84
76 3300044673 Ga0453683_1214361 Ga0453683_1214361_167_436 84
77 3300045051 Ga0451576_0495765 Ga0451576_0495765_30_287 84
78 3300046477 Ga0495664_0058616 Ga0495664_0058616_1443_1712 84
79 3300046517 Ga0495630_1133239 Ga0495630_1133239_67_327 84
80 3300046683 Ga0495658_0428555 Ga0495658_0428555_299_562 84
81 3300046689 Ga0495613_0245972 Ga0495613_0245972_803_1066 84
82 3300046689 Ga0495613_0576174 Ga0495613_0576174_307_570 84
83 3300047471 Ga0495684_0599540 Ga0495684_0599540_390_659 84
84 3300048904 Ga0496101_0091096 Ga0496101_0091096_1736_1999 84
85 3300048907 Ga0496104_0040256 Ga0496104_0040256_950_1213 84
86 3300048917 Ga0496114_0006585 Ga0496114_0006585_518_781 84
87 3300049569 Ga0501032_0000147 Ga0501032_0000147_50719_50976 84
88 3300049572 Ga0501036_0396709 Ga0501036_0396709_211_471 84
89 3300049573 Ga0501037_0586176 Ga0501037_0586176_264_521 84
90 3300049574 Ga0501038_0143612 Ga0501038_0143612_884_1141 84
91 3300049575 Ga0501039_0174706 Ga0501039_0174706_194_451 84
92 3300049581 Ga0501047_0231803 Ga0501047_0231803_767_1027 84
93 3300049674 Ga0501242_009258 Ga0501242_009258_489_749 84
94 3300053096 Ga0500641_0035438 Ga0500641_0035438_386_649 84
95 3300005293 Ga0065715_10558824 Ga0065715_105588241 85
96 3300005333 Ga0070677_10235613 Ga0070677_102356132 85
97 3300005347 Ga0070668_100476088 Ga0070668_1004760882 85
98 3300005445 Ga0070708_100503448 Ga0070708_1005034482 85
99 3300005468 Ga0070707_101054847 Ga0070707_1010548471 85
100 3300005615 Ga0070702_101865354 Ga0070702_1018653542 85
101 3300005842 Ga0068858_100676722 Ga0068858_1006767222 85
102 3300006028 Ga0070717_11008447 Ga0070717_110084472 85
103 3300006852 Ga0075433_10194484 Ga0075433_101944843 85
104 3300009553 Ga0105249_10001720 Ga0105249_1000172010 85
105 3300010375 Ga0105239_10065811 Ga0105239_100658114 85
106 3300011119 Ga0105246_10699513 Ga0105246_106995131 85
107 3300013105 Ga0157369_12473675 Ga0157369_124736752 85
108 3300013306 Ga0163162_10877933 Ga0163162_108779333 85
109 3300013306 Ga0163162_11799380 Ga0163162_117993801 85
110 3300013308 Ga0157375_13514026 Ga0157375_135140261 85
111 3300014326 Ga0157380_11392553 Ga0157380_113925531 85
112 3300017792 Ga0163161_10321563 Ga0163161_103215633 85
113 3300025961 Ga0207712_10075432 Ga0207712_100754322 85
114 3300026035 Ga0207703_11798078 Ga0207703_117980781 85
115 3300028653 Ga0265323_10005481 Ga0265323_100054815 85
116 3300029957 Ga0265324_10006907 Ga0265324_100069076 85
117 3300031238 Ga0265332_10039552 Ga0265332_100395523 85
118 3300031238 Ga0265332_10084251 Ga0265332_100842513 85
119 3300031242 Ga0265329_10003098 Ga0265329_100030984 85
120 3300031247 Ga0265340_10532507 Ga0265340_105325072 85
121 3300031249 Ga0265339_10004596 Ga0265339_100045967 85
122 3300031249 Ga0265339_10372957 Ga0265339_103729571 85
123 3300031344 Ga0265316_10001125 Ga0265316_1000112515 85
124 3300031711 Ga0265314_10107380 Ga0265314_101073802 85
125 3300031712 Ga0265342_10002071 Ga0265342_1000207119 85
126 3300035692 Ga0373935_0484752 Ga0373935_0484752_403_672 85
127 3300036712 Ga0316584_0931009 Ga0316584_0931009_299_571 85
128 3300037068 Ga0373925_0549738 Ga0373925_0549738_26_292 85
129 3300042993 Ga0439440_0074881 Ga0439440_0074881_374_643 85
130 3300044673 Ga0453683_0002471 Ga0453683_0002471_12205_12474 85
131 3300049575 Ga0501039_1321608 Ga0501039_1321608_37_306 85
132 3300049591 Ga0501075_0550255 Ga0501075_0550255_271_540 85
133 3300053093 Ga0500651_0000191 Ga0500651_0000191_34388_34660 85
134 3300053093 Ga0500651_0030593 Ga0500651_0030593_3071_3343 85
135 3300053123 Ga0500614_003042 Ga0500614_003042_256_528 85
136 3300053142 Ga0500577_0000302 Ga0500577_0000302_4208_4483 85
137 2088090003 LJN_F7QKVOU01EBMOY LJN_01178180 87
138 3300009093 Ga0105240_12422906 Ga0105240_124229062 87
139 3300010375 Ga0105239_10772292 Ga0105239_107722922 87
140 3300031235 Ga0265330_10388315 Ga0265330_103883152 87
141 3300031712 Ga0265342_10248175 Ga0265342_102481753 87
142 3300037312 Ga0395899_0302312 Ga0395899_0302312_218_487 87
143 3300042876 Ga0451577_1522854 Ga0451577_1522854_193_462 87
144 3300046525 Ga0495663_0010712 Ga0495663_0010712_1864_2133 87
145 3300046539 Ga0495621_0006068 Ga0495621_0006068_1045_1353 87
146 3300046558 Ga0495633_0248417 Ga0495633_0248417_518_787 87
147 3300046691 Ga0495670_0015964 Ga0495670_0015964_501_770 87
148 3300047318 Ga0495636_0258356 Ga0495636_0258356_512_781 87
149 3300047445 Ga0495677_0179846 Ga0495677_0179846_436_705 87

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

5

84

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g5o-assembly1.cif.gz_B the crystal structure of the toxin-antitoxin complex relbe2 (rv2865-2866) from mycobacterium tuberculosis 0.9056 1 79
3g5o-assembly1.cif.gz_C the crystal structure of the toxin-antitoxin complex relbe2 (rv2865-2866) from mycobacterium tuberculosis 0.9018 1 79
3g5o-assembly1.cif.gz_B the crystal structure of the toxin-antitoxin complex relbe2 (rv2865-2866) from mycobacterium tuberculosis 0.8745 1 79
8oiz-assembly1.cif.gz_A crystal structure of human crbn-ddb1 in complex with pomalidomide 0.858 51 81
3ei2-assembly1.cif.gz_A structure of hsddb1-drddb2 bound to a 16 bp abasic site containing dna-duplex 0.8501 51 81
ID Description Score Start End Superfamily
3g5oB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9056 1 79 3.30.2310.20
af_A0A2R8RLT5_222_342_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8908 53 79 2.30.29.30
3g5oB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8745 1 79 3.30.2310.20
af_Q8I666_66_473_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8675 53 79 2.130.10.10
af_A0A1D6FLI0_1_293_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8622 53 81 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A839DC35-F1-model_v4 deleted 0.991 1 81
AF-A0A6L4RZE4-F1-model_v4 deleted 0.979 1 76
AF-A0A7T9BS06-F1-model_v4 deleted 0.9753 1 82
AF-A0A2S1R3S9-F1-model_v4 Addiction module toxin RelE 0.969 1 82
AF-A0A5C9CRL0-F1-model_v4 RelE protein 0.9667 1 86

Feature Viewer

pLDDT pTM Quality
87.66 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map