F205210

General Info

Members Datasets Scaffolds Average Seq Length
149 89 298 98

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100749678|Ga0070688_1007496782
Length 115
Sequence MKSASYRRLPAGREPSKGLIMPRQPKSTAKTGPDSPQQTRLWLMYPPKLIREPLIWKLGHKFPVVTNVRQASVTDEIGIVSLELDGKRSDIKAAIKWLEKLGVSVEPVEINVIES

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
16 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
48 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
51 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
52 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
53 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
54 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
55 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
56 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
61 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
62 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
63 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
64 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
65 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
66 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
67 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
68 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
69 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
70 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
73 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
76 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
77 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
78 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
79 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
80 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
81 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
82 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
83 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
84 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
85 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
86 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
87 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
88 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
89 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.67
Rhizosphere 99.33
Stem 0
Stem Tuber 0
Unclassified 38.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100749678 3300005365 Unclassified 760
2 Ga0070666_10038102 3300005335 Bacteria 3198
3 Ga0070687_101041549 3300005343 Unclassified 595
4 Ga0070669_101618463 3300005353 Unclassified 564
5 Ga0070673_100326116 3300005364 Bacteria 1357
6 Ga0070688_100179253 3300005365 Bacteria 1468
7 Ga0070688_100450626 3300005365 Bacteria 962
8 Ga0070709_11752767 3300005434 Unclassified 508
9 Ga0070713_101060191 3300005436 Bacteria 783
10 Ga0070681_10686564 3300005458 Bacteria 939
11 Ga0068867_100826272 3300005459 Bacteria 828
12 Ga0070707_100250139 3300005468 Bacteria 1725
13 Ga0068857_100004435 3300005577 Bacteria 11872
14 Ga0068857_100442144 3300005577 Unclassified 1215
15 Ga0068857_102012994 3300005577 Unclassified 566
16 Ga0068859_100353356 3300005617 Unclassified 1565
17 Ga0068859_100384393 3300005617 Bacteria 1499
18 Ga0068859_100592848 3300005617 Bacteria 1202
19 Ga0068859_100812407 3300005617 Bacteria 1022
20 Ga0068859_102051879 3300005617 Unclassified 631
21 Ga0068859_102781521 3300005617 Bacteria 537
22 Ga0068864_100215489 3300005618 Unclassified 1770
23 Ga0068864_101291298 3300005618 Bacteria 730
24 Ga0068861_100959270 3300005719 Unclassified 814
25 Ga0070716_100623504 3300006173 Unclassified 814
26 Ga0097621_100740593 3300006237 Unclassified 907
27 Ga0097621_101708225 3300006237 Unclassified 599
28 Ga0068871_100662592 3300006358 Bacteria 953
29 Ga0097620_100353371 3300006931 Unclassified 1565
30 Ga0097620_100384388 3300006931 Bacteria 1499
31 Ga0097620_100592827 3300006931 Bacteria 1202
32 Ga0097620_100812647 3300006931 Bacteria 1022
33 Ga0097620_102051623 3300006931 Unclassified 631
34 Ga0097620_102781787 3300006931 Bacteria 537
35 Ga0105240_10975136 3300009093 Bacteria 908
36 Ga0111539_11119032 3300009094 Unclassified 915
37 Ga0105245_10549038 3300009098 Unclassified 1177
38 Ga0105245_11500292 3300009098 Unclassified 725
39 Ga0105245_11850335 3300009098 Unclassified 657
40 Ga0105242_10417756 3300009176 Unclassified 1256
41 Ga0105242_10698424 3300009176 Bacteria 992
42 Ga0105248_10496955 3300009177 Bacteria 1375
43 Ga0105248_11874573 3300009177 Unclassified 680
44 Ga0105238_10212111 3300009551 Bacteria 1912
45 Ga0105249_12483584 3300009553 Unclassified 591
46 Ga0157374_10676764 3300013296 Bacteria 1044
47 Ga0157374_11335616 3300013296 Unclassified 739
48 Ga0157374_11727284 3300013296 Bacteria 651
49 Ga0157374_12041709 3300013296 Unclassified 600
50 Ga0163162_13233674 3300013306 Unclassified 523
51 Ga0157375_10000048 3300013308 Bacteria 140600
52 Ga0157375_10634313 3300013308 Bacteria 1226
53 Ga0157375_11870723 3300013308 Unclassified 712
54 Ga0157375_12586783 3300013308 Bacteria 606
55 Ga0157375_12655850 3300013308 Bacteria 598
56 Ga0163163_10000049 3300014325 Bacteria 130036
57 Ga0163163_10030700 3300014325 Bacteria 5181
58 Ga0163163_10110527 3300014325 Bacteria 2777
59 Ga0157377_10687045 3300014745 Unclassified 741
60 Ga0157376_10386289 3300014969 Unclassified 1350
61 Ga0207680_10042563 3300025903 Bacteria 2657
62 Ga0207643_11025130 3300025908 Unclassified 533
63 Ga0207707_10512208 3300025912 Bacteria 1022
64 Ga0207646_10501290 3300025922 Bacteria 1094
65 Ga0207646_11745400 3300025922 Unclassified 534
66 Ga0207694_10144882 3300025924 Bacteria 1912
67 Ga0207659_11292590 3300025926 Unclassified 626
68 Ga0207687_11390283 3300025927 Unclassified 603
69 Ga0207711_11227204 3300025941 Unclassified 691
70 Ga0207651_10286005 3300025960 Bacteria 1365
71 Ga0207648_10808573 3300026089 Bacteria 873
72 Ga0207676_10017929 3300026095 Bacteria 5137
73 Ga0207676_10028681 3300026095 Bacteria 4160
74 Ga0207676_10910447 3300026095 Bacteria 863
75 Ga0207674_10008308 3300026116 Bacteria 12016
76 Ga0207674_10264136 3300026116 Unclassified 1669
77 Ga0207675_100145401 3300026118 Unclassified 2254
78 Ga0265326_10011415 3300028558 Bacteria 2618
79 Ga0265326_10226468 3300028558 Bacteria 538
80 Ga0265338_10000016 3300028800 Bacteria 347424
81 Ga0265338_10000440 3300028800 Bacteria 74544
82 Ga0265338_10008404 3300028800 Bacteria 12539
83 Ga0265338_10011197 3300028800 Bacteria 10396
84 Ga0265338_10061864 3300028800 Bacteria 3278
85 Ga0265324_10001648 3300029957 Bacteria 12344
86 Ga0265325_10073781 3300031241 Bacteria 1708
87 Ga0307408_102428766 3300031548 Unclassified 509
88 Ga0373940_0031313 3300035088 Bacteria 1419
89 Ga0373951_0076502 3300035091 Bacteria 860
90 Ga0373951_0253701 3300035091 Bacteria 529
91 Ga0373954_0019809 3300035118 Bacteria 3037
92 Ga0373956_0278201 3300035119 Bacteria 796
93 Ga0373955_0372698 3300035172 Bacteria 866
94 Ga0373931_0558744 3300035691 Bacteria 744
95 Ga0373933_0607763 3300035724 Bacteria 718
96 Ga0373937_0144460 3300036401 Bacteria 2227
97 Ga0451797_0470621 3300041453 Unclassified 500
98 Ga0451576_0058752 3300045051 Bacteria 4017
99 Ga0451576_0208868 3300045051 Unclassified 2039
100 Ga0451576_0265398 3300045051 Bacteria 1795
101 Ga0451576_0727935 3300045051 Bacteria 1042
102 Ga0495592_0000012 3300046454 Bacteria 154054
103 Ga0495592_0873292 3300046454 Unclassified 530
104 Ga0495641_0048732 3300046461 Bacteria 1941
105 Ga0495651_0768448 3300046462 Bacteria 596
106 Ga0495582_0109416 3300046473 Unclassified 1552
107 Ga0495662_0012004 3300046476 Bacteria 4235
108 Ga0495662_0160569 3300046476 Bacteria 1107
109 Ga0495664_0070378 3300046477 Unclassified 2089
110 Ga0495608_0952091 3300046511 Unclassified 501
111 Ga0495618_0005516 3300046514 Bacteria 7703
112 Ga0495628_0000246 3300046516 Bacteria 47770
113 Ga0495630_0011428 3300046517 Bacteria 6432
114 Ga0495630_0045447 3300046517 Bacteria 3282
115 Ga0495666_0204607 3300046526 Unclassified 907
116 Ga0495666_0245616 3300046526 Unclassified 816
117 Ga0495652_0030152 3300046529 Bacteria 4760
118 Ga0495586_0000364 3300046535 Bacteria 28053
119 Ga0495586_0019330 3300046535 Unclassified 3624
120 Ga0495645_0015200 3300046543 Bacteria 5473
121 Ga0495645_0068676 3300046543 Bacteria 2558
122 Ga0495645_0351861 3300046543 Bacteria 949
123 Ga0495645_0430125 3300046543 Bacteria 836
124 Ga0495645_0803887 3300046543 Unclassified 564
125 Ga0495634_0066008 3300046642 Bacteria 2397
126 Ga0495588_0638452 3300046674 Unclassified 557
127 Ga0495599_0153689 3300046678 Bacteria 1424
128 Ga0495646_0273517 3300046680 Bacteria 899
129 Ga0495647_0425745 3300046681 Unclassified 612
130 Ga0495658_0031504 3300046683 Unclassified 2889
131 Ga0495658_1037820 3300046683 Unclassified 523
132 Ga0495613_0009330 3300046689 Bacteria 7282
133 Ga0495613_0270240 3300046689 Bacteria 1183
134 Ga0495613_1108352 3300046689 Unclassified 505
135 Ga0495624_0061318 3300046690 Bacteria 2357
136 Ga0495581_0697069 3300047315 Bacteria 586
137 Ga0495581_0779098 3300047315 Bacteria 549
138 Ga0495674_0004100 3300047319 Bacteria 14077
139 Ga0495674_0697038 3300047319 Unclassified 797
140 Ga0495676_0157491 3300047321 Bacteria 1610
141 Ga0495684_0563116 3300047471 Unclassified 774
142 Ga0495614_0509015 3300048089 Unclassified 573
143 nmdc:mga08y16_1153148_c1 3300050511 Bacteria 748
144 nmdc:mga08y16_647751_c1 3300050511 Unclassified 1061
145 nmdc:mga0n895_1167029_c1 3300050512 Unclassified 745
146 nmdc:mga0n895_450092_c1 3300050512 Bacteria 1300
147 nmdc:mga0n895_788512_c1 3300050512 Bacteria 941
148 nmdc:mga0n895_952056_c1 3300050512 Bacteria 842
149 nmdc:mga0rr50_153142_c1 3300050513 Unclassified 1865
150 Ga0070688_100749678
151 Ga0070666_10038102
152 Ga0070687_101041549
153 Ga0070669_101618463
154 Ga0070673_100326116
155 Ga0070688_100179253
156 Ga0070688_100450626
157 Ga0070709_11752767
158 Ga0070713_101060191
159 Ga0070681_10686564
160 Ga0068867_100826272
161 Ga0070707_100250139
162 Ga0068857_100004435
163 Ga0068857_100442144
164 Ga0068857_102012994
165 Ga0068859_100353356
166 Ga0068859_100384393
167 Ga0068859_100592848
168 Ga0068859_100812407
169 Ga0068859_102051879
170 Ga0068859_102781521
171 Ga0068864_100215489
172 Ga0068864_101291298
173 Ga0068861_100959270
174 Ga0070716_100623504
175 Ga0097621_100740593
176 Ga0097621_101708225
177 Ga0068871_100662592
178 Ga0097620_100353371
179 Ga0097620_100384388
180 Ga0097620_100592827
181 Ga0097620_100812647
182 Ga0097620_102051623
183 Ga0097620_102781787
184 Ga0105240_10975136
185 Ga0111539_11119032
186 Ga0105245_10549038
187 Ga0105245_11500292
188 Ga0105245_11850335
189 Ga0105242_10417756
190 Ga0105242_10698424
191 Ga0105248_10496955
192 Ga0105248_11874573
193 Ga0105238_10212111
194 Ga0105249_12483584
195 Ga0157374_10676764
196 Ga0157374_11335616
197 Ga0157374_11727284
198 Ga0157374_12041709
199 Ga0163162_13233674
200 Ga0157375_10000048
201 Ga0157375_10634313
202 Ga0157375_11870723
203 Ga0157375_12586783
204 Ga0157375_12655850
205 Ga0163163_10000049
206 Ga0163163_10030700
207 Ga0163163_10110527
208 Ga0157377_10687045
209 Ga0157376_10386289
210 Ga0207680_10042563
211 Ga0207643_11025130
212 Ga0207707_10512208
213 Ga0207646_10501290
214 Ga0207646_11745400
215 Ga0207694_10144882
216 Ga0207659_11292590
217 Ga0207687_11390283
218 Ga0207711_11227204
219 Ga0207651_10286005
220 Ga0207648_10808573
221 Ga0207676_10017929
222 Ga0207676_10028681
223 Ga0207676_10910447
224 Ga0207674_10008308
225 Ga0207674_10264136
226 Ga0207675_100145401
227 Ga0265326_10011415
228 Ga0265326_10226468
229 Ga0265338_10000016
230 Ga0265338_10000440
231 Ga0265338_10008404
232 Ga0265338_10011197
233 Ga0265338_10061864
234 Ga0265324_10001648
235 Ga0265325_10073781
236 Ga0307408_102428766
237 Ga0373940_0031313
238 Ga0373951_0076502
239 Ga0373951_0253701
240 Ga0373954_0019809
241 Ga0373956_0278201
242 Ga0373955_0372698
243 Ga0373931_0558744
244 Ga0373933_0607763
245 Ga0373937_0144460
246 Ga0451797_0470621
247 Ga0451576_0058752
248 Ga0451576_0208868
249 Ga0451576_0265398
250 Ga0451576_0727935
251 Ga0495592_0000012
252 Ga0495592_0873292
253 Ga0495641_0048732
254 Ga0495651_0768448
255 Ga0495582_0109416
256 Ga0495662_0012004
257 Ga0495662_0160569
258 Ga0495664_0070378
259 Ga0495608_0952091
260 Ga0495618_0005516
261 Ga0495628_0000246
262 Ga0495630_0011428
263 Ga0495630_0045447
264 Ga0495666_0204607
265 Ga0495666_0245616
266 Ga0495652_0030152
267 Ga0495586_0000364
268 Ga0495586_0019330
269 Ga0495645_0015200
270 Ga0495645_0068676
271 Ga0495645_0351861
272 Ga0495645_0430125
273 Ga0495645_0803887
274 Ga0495634_0066008
275 Ga0495588_0638452
276 Ga0495599_0153689
277 Ga0495646_0273517
278 Ga0495647_0425745
279 Ga0495658_0031504
280 Ga0495658_1037820
281 Ga0495613_0009330
282 Ga0495613_0270240
283 Ga0495613_1108352
284 Ga0495624_0061318
285 Ga0495581_0697069
286 Ga0495581_0779098
287 Ga0495674_0004100
288 Ga0495674_0697038
289 Ga0495676_0157491
290 Ga0495684_0563116
291 Ga0495614_0509015
292 nmdc:mga08y16_1153148_c1
293 nmdc:mga08y16_647751_c1
294 nmdc:mga0n895_1167029_c1
295 nmdc:mga0n895_450092_c1
296 nmdc:mga0n895_788512_c1
297 nmdc:mga0n895_952056_c1
298 nmdc:mga0rr50_153142_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09383

NIL

NIL domain

39

107

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dhw-assembly1.cif.gz_D crystal structure of methionine importer metni 0.9171 21 90
6cvl-assembly1.cif.gz_D crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.8598 21 91
3dhx-assembly1.cif.gz_B crystal structure of isolated c2 domain of the methionine uptake transporter 0.8552 21 89
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.8402 21 90
6cvl-assembly1.cif.gz_C crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.8342 21 91
ID Description Score Start End Superfamily
af_Q57563_9_68_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9202 28 83 3.30.70.260
3tuzH02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8963 21 89 3.30.70.260
af_P30750_246_343_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8831 21 91 3.30.70.260
af_Q57563_9_68_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8507 28 83 3.30.70.260
2qswA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7981 22 94 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A2H5WEC5-F1-model_v4 NIL domain-containing protein 0.9798 20 92
AF-A0A2V6C7G2-F1-model_v4 NIL domain-containing protein 0.979 19 98
AF-A0A7Y5HG21-F1-model_v4 NIL domain-containing protein 0.9783 20 92
AF-A0A7C2DNL6-F1-model_v4 FeS-binding protein 0.9776 20 92
AF-A0A537ZLG7-F1-model_v4 NIL domain-containing protein 0.976 18 92

Map