F200388

General Info

Members Datasets Scaffolds Average Seq Length
147 125 108 227

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10079999|Ga0157372_100799992
Length 249
Sequence MAQAAAAAGATAPRAAEGGQDRVIEELLPDEVVAVEVHGDDGSEPAPLYPEEAEAVAQAVHKRRREFALVRACARRAMEKLGVPAQPVLPGERGAPGWPPGLAGSMTHCDGYCAAALVRATDLASVGIDAEPHRPLPDGVLDAVALPAEAARLRRLAVRHPEVHWDRLLFSAKESVYKAWFPLTGLWLEFAEADIEGSADPDERLHGGFRAELLVPGPLVGGRRLGHFEGRWTVQRGLVATAIAVPHPR

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2643221647 Streptomyces sp. Root369 Isolate Unclassified
6 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
7 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
8 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
9 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
10 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
11 2808606448 Streptomyces sp. 193411 Isolate Unclassified
12 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
13 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
14 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
15 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
16 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
17 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
18 2867428634 Streptomyces sp. RP5T Isolate Unclassified
19 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
20 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
21 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
22 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
23 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
24 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
25 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
26 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
27 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
28 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
29 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
30 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
31 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
32 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
33 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
34 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
35 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
36 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
37 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
38 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
66 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
69 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
72 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
73 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
76 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
77 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
78 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
79 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
80 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
81 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
82 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
91 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
102 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
105 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
106 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
107 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
119 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
122 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
123 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
124 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
125 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.43
Metatranscriptomes 2.04
Isolates 26.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.8
Nodule 0.68
Rhizoplane 0
Rhizosphere 72.79
Stem 0
Stem Tuber 0
Unclassified 19.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10060744 3300003316 Bacteria 2277
2 Ga0006562J51391_1117865 3300003578 Bacteria 4370
3 Ga0006562J51391_1117867 3300003578 Bacteria 3920
4 Ga0070675_100006447 3300005354 Bacteria 9006
5 Ga0070713_100012888 3300005436 Bacteria 6150
6 Ga0068856_100030940 3300005614 Bacteria 5235
7 Ga0081455_10199369 3300005937 Bacteria 1500
8 Ga0075368_10082404 3300006042 Bacteria 1310
9 Ga0075363_100008523 3300006048 Bacteria 4778
10 Ga0070715_10085984 3300006163 Bacteria 1437
11 Ga0075367_10001724 3300006178 Bacteria 9565
12 Ga0075370_10047796 3300006353 Bacteria 2423
13 Ga0099826_10116054 3300006948 Bacteria 1586
14 Ga0157370_10114792 3300013104 Bacteria 2516
15 Ga0157372_10079999 3300013307 Bacteria 3697
16 Ga0182007_10007469 3300015262 Bacteria 4578
17 Ga0183367_1001 3300015688 Bacteria 1225545
18 Ga0224712_10152604 3300022467 Bacteria 1025
19 Ga0207647_10015990 3300025904 Bacteria 5129
20 Ga0207699_10088438 3300025906 Bacteria 1939
21 Ga0207663_10071914 3300025916 Bacteria 2234
22 Ga0207659_10002038 3300025926 Bacteria 11986
23 Ga0207700_10006725 3300025928 Bacteria 6980
24 Ga0207667_10203632 3300025949 Bacteria 2030
25 Ga0207639_10140870 3300026041 Bacteria 2009
26 Ga0207702_10071999 3300026078 Bacteria 2978
27 Ga0207674_10299542 3300026116 Bacteria 1557
28 Ga0209813_10007183 3300027866 Bacteria 2769
29 Ga0307515_10000441 3300028794 Bacteria 99819
30 Ga0307511_10000078 3300030521 Bacteria 81896
31 Ga0307509_10174035 3300031507 Bacteria 2027
32 Ga0307408_100787700 3300031548 Bacteria 862
33 Ga0307508_10002224 3300031616 Bacteria 20663
34 Ga0307508_10168740 3300031616 Bacteria 1792
35 Ga0307514_10016264 3300031649 Bacteria 6126
36 Ga0307516_10003173 3300031730 Bacteria 21387
37 Ga0307516_10023506 3300031730 Bacteria 6317
38 Ga0307518_10047290 3300031838 Bacteria 3128
39 Ga0307518_10116179 3300031838 Bacteria 1900
40 Ga0307507_10035810 3300033179 Bacteria 5089
41 Ga0307510_10056212 3300033180 Bacteria 4101
42 Ga0307510_10079207 3300033180 Bacteria 3205
43 Ga0307510_10140582 3300033180 Bacteria 2059
44 Ga0395898_0010976 3300037466 Bacteria 9443
45 Ga0395898_0052485 3300037466 Bacteria 3983
46 Ga0439442_045874 3300042002 Bacteria 921
47 Ga0439448_0010950 3300042005 Bacteria 2698
48 Ga0439449_0000322 3300042007 Bacteria 17394
49 Ga0439455_0002713 3300042012 Bacteria 3268
50 Ga0439462_0026622 3300042015 Bacteria 1524
51 Ga0450903_000353 3300042138 Bacteria 10082
52 Ga0439458_0004157 3300042157 Bacteria 3340
53 Ga0450901_005624 3300042533 Bacteria 1286
54 Ga0466963_0010658 3300044694 Bacteria 5575
55 Ga0466970_0018831 3300044765 Bacteria 3576
56 Ga0466967_0011009 3300045976 Bacteria 6824
57 Ga0466967_0055387 3300045976 Bacteria 3493
58 Ga0495592_0014087 3300046454 Bacteria 6075
59 Ga0495629_0011550 3300046459 Bacteria 6414
60 Ga0495583_0017964 3300046506 Bacteria 3738
61 Ga0495608_0083473 3300046511 Bacteria 2074
62 Ga0495618_0038509 3300046514 Bacteria 3005
63 Ga0495620_0012789 3300046515 Bacteria 4318
64 Ga0495628_0123179 3300046516 Bacteria 1987
65 Ga0495628_0130044 3300046516 Bacteria 1926
66 Ga0495643_0005116 3300046522 Bacteria 8968
67 Ga0495643_0098279 3300046522 Bacteria 1503
68 Ga0495652_0074559 3300046529 Bacteria 2821
69 Ga0495640_0011034 3300046533 Bacteria 6959
70 Ga0495625_0005701 3300046660 Bacteria 11276
71 Ga0495588_0006250 3300046674 Bacteria 5353
72 Ga0495657_0072511 3300046675 Bacteria 2245
73 Ga0495613_0023133 3300046689 Bacteria 4631
74 Ga0495613_0032284 3300046689 Bacteria 3888
75 Ga0495613_0413566 3300046689 Bacteria 918
76 Ga0495624_0038553 3300046690 Bacteria 3070
77 Ga0495671_0002644 3300046692 Bacteria 11257
78 Ga0495581_0132855 3300047315 Bacteria 1450
79 Ga0495604_0000584 3300047317 Bacteria 31824
80 Ga0495604_0080339 3300047317 Bacteria 2443
81 Ga0495687_005589 3300047443 Bacteria 7959
82 Ga0495687_056973 3300047443 Bacteria 1627
83 Ga0495687_113771 3300047443 Bacteria 989
84 Ga0495685_002542 3300047447 Bacteria 5730
85 Ga0495685_049428 3300047447 Bacteria 1428
86 Ga0495681_0002761 3300047470 Bacteria 12422
87 Ga0495593_0005613 3300047673 Bacteria 7407
88 Ga0495593_0045350 3300047673 Bacteria 2346
89 Ga0495602_0264577 3300048088 Bacteria 1274
90 Ga0495614_0074665 3300048089 Bacteria 1464
91 Ga0495614_0207116 3300048089 Bacteria 888
92 Ga0501034_0032723 3300049571 Bacteria 5280
93 Ga0501038_0004113 3300049574 Bacteria 13535
94 Ga0501038_0152523 3300049574 Bacteria 1883
95 Ga0501039_0212116 3300049575 Bacteria 1523
96 Ga0501046_0054443 3300049580 Bacteria 3147
97 Ga0501046_0066473 3300049580 Bacteria 2810
98 Ga0501047_0060049 3300049581 Bacteria 3671
99 Ga0501080_0205041 3300049742 Bacteria 1809
100 Ga0501035_0420611 3300049822 Bacteria 1109
101 Ga0501044_0000854 3300049823 Bacteria 36617
102 Ga0501044_0004910 3300049823 Bacteria 14946
103 Ga0501044_0064904 3300049823 Bacteria 3724
104 nmdc:mga03n38_26709_c1 3300050490 Bacteria 2387
105 nmdc:mga04h51_31491_c1 3300050495 Bacteria 1676
106 nmdc:mga07m45_6558_c3 3300050496 Bacteria 4472
107 Ga0500578_0261593 3300053086 Bacteria 1039
108 Ga0500560_003318 3300053107 Bacteria 3239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0054443 Ga0501046_0054443_1453_2217 208
2 3300049822 Ga0501035_0420611 Ga0501035_0420611_114_878 208
3 iso_pu_bacteria 2554235005 2554260366 209
4 iso_pu_bacteria 8001781756 8001787334 212
5 3300031616 Ga0307508_10002224 Ga0307508_1000222414 213
6 iso_pu_bacteria 2811994879 2812354503 214
7 iso_pu_bacteria 2852635781 2852636121 214
8 iso_pu_bacteria 2946064051 2946071200 214
9 3300005436 Ga0070713_100012888 Ga0070713_1000128885 216
10 3300005614 Ga0068856_100030940 Ga0068856_1000309405 216
11 3300013104 Ga0157370_10114792 Ga0157370_101147922 216
12 3300025906 Ga0207699_10088438 Ga0207699_100884382 216
13 3300025928 Ga0207700_10006725 Ga0207700_100067256 216
14 3300026078 Ga0207702_10071999 Ga0207702_100719992 216
15 3300046522 Ga0495643_0098279 Ga0495643_0098279_427_1080 216
16 3300042002 Ga0439442_045874 Ga0439442_045874_205_861 217
17 3300042015 Ga0439462_0026622 Ga0439462_0026622_568_1224 217
18 3300049574 Ga0501038_0152523 Ga0501038_0152523_658_1353 217
19 3300049580 Ga0501046_0066473 Ga0501046_0066473_23_718 217
20 3300049823 Ga0501044_0000854 Ga0501044_0000854_33585_34280 217
21 iso_pu_bacteria 2818991472 2819746303 217
22 3300003578 Ga0006562J51391_1117865 Ga0006562J51391_11178655 218
23 3300003578 Ga0006562J51391_1117867 Ga0006562J51391_11178672 218
24 3300005354 Ga0070675_100006447 Ga0070675_1000064478 218
25 3300025916 Ga0207663_10071914 Ga0207663_100719142 218
26 3300025926 Ga0207659_10002038 Ga0207659_100020388 218
27 3300047317 Ga0495604_0000584 Ga0495604_0000584_24701_25360 218
28 3300047447 Ga0495685_049428 Ga0495685_049428_560_1249 219
29 3300026041 Ga0207639_10140870 Ga0207639_101408702 220
30 iso_pu_bacteria 2811994917 2812477467 220
31 iso_pu_bacteria 2862507626 2862512178 220
32 iso_pu_bacteria 2947224130 2947225566 220
33 iso_pu_bacteria 2547132111 2547412098 221
34 iso_pu_bacteria 2582581313 2585303949 221
35 iso_pu_bacteria 2616644814 2616699098 221
36 iso_pu_bacteria 2643221647 2644266494 221
37 iso_pu_bacteria 2784132148 2784591832 221
38 iso_pu_bacteria 2784746768 2785372844 221
39 iso_pu_bacteria 2786546132 2786675132 221
40 iso_pu_bacteria 2808606359 2808845195 221
41 iso_pu_bacteria 2808606375 2808914792 221
42 iso_pu_bacteria 2808606448 2809235452 221
43 iso_pu_bacteria 2862281513 2862283183 221
44 iso_pu_bacteria 2867428634 2867431665 221
45 iso_pu_bacteria 2877676314 2877677850 221
46 iso_pu_bacteria 2912715099 2912716113 221
47 iso_pu_bacteria 2912723979 2912729049 221
48 iso_pu_bacteria 2919468124 2919470997 221
49 iso_pu_bacteria 2954380949 2954382639 221
50 iso_pu_bacteria 2954673503 2954680243 221
51 iso_pu_bacteria 2954682443 2954683908 221
52 iso_pu_bacteria 2954691527 2954693461 221
53 iso_pu_bacteria 2954701450 2954708555 221
54 iso_pu_bacteria 2954711539 2954713126 221
55 iso_pu_bacteria 2954721474 2954723086 221
56 iso_pu_bacteria 2954731030 2954738744 221
57 iso_pu_bacteria 2954740390 2954741993 221
58 iso_pu_bacteria 2954749733 2954757601 221
59 iso_pu_bacteria 2954759201 2954760970 221
60 iso_pu_bacteria 3006493962 3006501711 221
61 iso_pu_bacteria 8008574985 8008575964 221
62 iso_pu_bacteria 8056829672 8056836004 221
63 3300031548 Ga0307408_100787700 Ga0307408_1007877002 224
64 3300003316 rootH1_10060744 rootH1_100607441 225
65 3300005937 Ga0081455_10199369 Ga0081455_101993692 225
66 3300006042 Ga0075368_10082404 Ga0075368_100824042 225
67 3300006048 Ga0075363_100008523 Ga0075363_1000085236 225
68 3300006163 Ga0070715_10085984 Ga0070715_100859842 225
69 3300006178 Ga0075367_10001724 Ga0075367_100017244 225
70 3300006353 Ga0075370_10047796 Ga0075370_100477963 225
71 3300006948 Ga0099826_10116054 Ga0099826_101160543 225
72 3300013307 Ga0157372_10079999 Ga0157372_100799992 225
73 3300015262 Ga0182007_10007469 Ga0182007_100074696 225
74 3300015688 Ga0183367_1001 Ga0183367_1001765 225
75 3300022467 Ga0224712_10152604 Ga0224712_101526042 225
76 3300025904 Ga0207647_10015990 Ga0207647_100159901 225
77 3300025949 Ga0207667_10203632 Ga0207667_102036323 225
78 3300026116 Ga0207674_10299542 Ga0207674_102995423 225
79 3300027866 Ga0209813_10007183 Ga0209813_100071832 225
80 3300028794 Ga0307515_10000441 Ga0307515_1000044151 225
81 3300030521 Ga0307511_10000078 Ga0307511_1000007841 225
82 3300031507 Ga0307509_10174035 Ga0307509_101740352 225
83 3300031616 Ga0307508_10168740 Ga0307508_101687403 225
84 3300031649 Ga0307514_10016264 Ga0307514_100162643 225
85 3300031730 Ga0307516_10003173 Ga0307516_100031733 225
86 3300031730 Ga0307516_10023506 Ga0307516_100235065 225
87 3300031838 Ga0307518_10047290 Ga0307518_100472904 225
88 3300031838 Ga0307518_10116179 Ga0307518_101161792 225
89 3300033179 Ga0307507_10035810 Ga0307507_100358101 225
90 3300033180 Ga0307510_10056212 Ga0307510_100562125 225
91 3300033180 Ga0307510_10079207 Ga0307510_100792073 225
92 3300033180 Ga0307510_10140582 Ga0307510_101405822 225
93 3300037466 Ga0395898_0010976 Ga0395898_0010976_6085_6771 225
94 3300037466 Ga0395898_0052485 Ga0395898_0052485_2484_3164 225
95 3300042005 Ga0439448_0010950 Ga0439448_0010950_54_734 225
96 3300042007 Ga0439449_0000322 Ga0439449_0000322_3294_3983 225
97 3300042012 Ga0439455_0002713 Ga0439455_0002713_12_692 225
98 3300042138 Ga0450903_000353 Ga0450903_000353_2712_3392 225
99 3300042157 Ga0439458_0004157 Ga0439458_0004157_1058_1738 225
100 3300042533 Ga0450901_005624 Ga0450901_005624_314_994 225
101 3300044694 Ga0466963_0010658 Ga0466963_0010658_2277_2966 225
102 3300044765 Ga0466970_0018831 Ga0466970_0018831_2254_2973 225
103 3300045976 Ga0466967_0011009 Ga0466967_0011009_451_1140 225
104 3300045976 Ga0466967_0055387 Ga0466967_0055387_2188_2868 225
105 3300046454 Ga0495592_0014087 Ga0495592_0014087_3750_4445 225
106 3300046459 Ga0495629_0011550 Ga0495629_0011550_4123_4845 225
107 3300046506 Ga0495583_0017964 Ga0495583_0017964_2473_3165 225
108 3300046511 Ga0495608_0083473 Ga0495608_0083473_347_1039 225
109 3300046514 Ga0495618_0038509 Ga0495618_0038509_2073_2768 225
110 3300046515 Ga0495620_0012789 Ga0495620_0012789_3228_3920 225
111 3300046516 Ga0495628_0123179 Ga0495628_0123179_529_1221 225
112 3300046516 Ga0495628_0130044 Ga0495628_0130044_93_788 225
113 3300046522 Ga0495643_0005116 Ga0495643_0005116_2199_2891 225
114 3300046529 Ga0495652_0074559 Ga0495652_0074559_1547_2239 225
115 3300046533 Ga0495640_0011034 Ga0495640_0011034_986_1678 225
116 3300046660 Ga0495625_0005701 Ga0495625_0005701_1246_1968 225
117 3300046674 Ga0495588_0006250 Ga0495588_0006250_1050_1772 225
118 3300046675 Ga0495657_0072511 Ga0495657_0072511_548_1243 225
119 3300046689 Ga0495613_0023133 Ga0495613_0023133_3039_3731 225
120 3300046689 Ga0495613_0032284 Ga0495613_0032284_2817_3512 225
121 3300046689 Ga0495613_0413566 Ga0495613_0413566_168_863 225
122 3300046690 Ga0495624_0038553 Ga0495624_0038553_725_1420 225
123 3300046692 Ga0495671_0002644 Ga0495671_0002644_5164_5886 225
124 3300047315 Ga0495581_0132855 Ga0495581_0132855_32_727 225
125 3300047317 Ga0495604_0080339 Ga0495604_0080339_124_819 225
126 3300047443 Ga0495687_005589 Ga0495687_005589_468_1148 225
127 3300047443 Ga0495687_056973 Ga0495687_056973_825_1517 225
128 3300047443 Ga0495687_113771 Ga0495687_113771_111_803 225
129 3300047447 Ga0495685_002542 Ga0495685_002542_3436_4116 225
130 3300047470 Ga0495681_0002761 Ga0495681_0002761_10648_11370 225
131 3300047673 Ga0495593_0005613 Ga0495593_0005613_3633_4328 225
132 3300047673 Ga0495593_0045350 Ga0495593_0045350_1061_1753 225
133 3300048088 Ga0495602_0264577 Ga0495602_0264577_57_752 225
134 3300048089 Ga0495614_0074665 Ga0495614_0074665_545_1240 225
135 3300048089 Ga0495614_0207116 Ga0495614_0207116_63_785 225
136 3300049571 Ga0501034_0032723 Ga0501034_0032723_31_720 225
137 3300049574 Ga0501038_0004113 Ga0501038_0004113_7943_8632 225
138 3300049575 Ga0501039_0212116 Ga0501039_0212116_307_996 225
139 3300049581 Ga0501047_0060049 Ga0501047_0060049_1498_2187 225
140 3300049742 Ga0501080_0205041 Ga0501080_0205041_494_1183 225
141 3300049823 Ga0501044_0004910 Ga0501044_0004910_5017_5697 225
142 3300049823 Ga0501044_0064904 Ga0501044_0064904_2386_3075 225
143 3300050490 nmdc:mga03n38_26709_c1 nmdc:mga03n38_26709_c1_284_964 225
144 3300050495 nmdc:mga04h51_31491_c1 nmdc:mga04h51_31491_c1_381_1067 225
145 3300050496 nmdc:mga07m45_6558_c3 nmdc:mga07m45_6558_c3_1452_2132 225
146 3300053086 Ga0500578_0261593 Ga0500578_0261593_25_711 225
147 3300053107 Ga0500560_003318 Ga0500560_003318_1455_2177 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17837

4PPT_N

4'-phosphopantetheinyl transferase N-terminal domain

51

118

0.97

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

125

217

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ct5-assembly2.cif.gz_B pptt pap(coa) 8918 complex 0.9416 2 223
4qvh-assembly1.cif.gz_B-2 crystal structure of the essential mycobacterium tuberculosis phosphopantetheinyl transferase pptt, solved as a fusion protein with maltose binding protein 0.9343 1 222
7ed2-assembly1.cif.gz_B transferase from mycobacterium smegmatis 0.9326 2 223
6qwu-assembly1.cif.gz_A 4'-phosphopantetheinyl transferase pptab from mycobacterium abscessus at ph 5.5 with mn2+ and coa. 0.928 1 223
4qjl-assembly1.cif.gz_A crystal structure of m. ulcerans phosphopantetheinyl transferase muppt 0.9278 1 223
ID Description Score Start End Superfamily
af_O33336_36_103_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9674 30 94 3.90.470.20
af_O33336_110_196_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9433 102 178 3.90.470.20
af_O33336_36_103_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.913 30 94 3.90.470.20
af_O33336_110_196_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8054 102 178 3.90.470.20
af_P19925_103_206_3.40.449.10 Alpha Beta;3-Layer(aba) Sandwich;Phosphoenolpyruvate Carboxykinase; domain 1;Phosphoenolpyruvate Carboxykinase, domain 1 0.7033 103 222 3.40.449.10
ID Description Score Start End GO Terms
AF-A0A7K2MRC1-F1-model_v4 4'-phosphopantetheinyl transferase superfamily protein 0.9939 103 225 GO:0000287
GO:0005886
GO:0008897
GO:0009239
GO:0009366
AF-A0A1X4HW02-F1-model_v4 4'-phosphopantetheinyl transferase 0.991 51 225 GO:0000287
GO:0005886
GO:0008897
GO:0009239
GO:0009366
AF-A0A0B5DIE6-F1-model_v4 4'-phosphopantetheinyl transferase 0.9814 1 225 GO:0000287
GO:0005886
GO:0008897
GO:0009239
GO:0009366
AF-A0A7K2IEQ2-F1-model_v4 4'-phosphopantetheinyl transferase superfamily protein 0.9808 11 225 GO:0000287
GO:0005886
GO:0008897
GO:0009239
GO:0009366
AF-A0A1X4HW02-F1-model_v4 4'-phosphopantetheinyl transferase 0.9799 51 225 GO:0000287
GO:0005886
GO:0008897
GO:0009239
GO:0009366

Feature Viewer

pLDDT pTM Quality
91.45 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map