F196147

General Info

Members Datasets Scaffolds Average Seq Length
145 88 290 499

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2902799365|2902800077
Length 565
Sequence FVRTQLIIFTVASIVGVAIMMFAYVQVPTLLGLGRLTVKLDLPATGGLYKFSNVTYRGLQVGKVTSVDLTDTGAQATLSLDTSPKIPADLKAEVRSMSAVGEQYVELLPRSDKAPYLQDGSVIPVGNSSIPQAVGPMLDQVSKLVGSIPKDKLSQLLGETYQAFNGTGYDFGSLVDSGATITRDANGISDNTRALIDDARPFVGAQEMTTDAIRTWAQSLAGITGQVADNDPQFRSILHNGPGFAQETSQLLEQIKPTLPVLLANMTTFGQIFLTYNKSVEQLLVLVPPFVAQIQTYAPTNNPTGLPNGDFSLGLGDPAACTVGFLPPSSWRNPADTSVIDTPDGLYCKLPQDSPVAVRGARNYPCQDHPGKRAPTVELCNDPNGFQPLAQRQHVTGPYPIDPGLVAQGIPVDSRALPSSNLFGPLQGTPLPPGVTAPPPGAPPVDPPPPNFAGTGPGPLLPGQPIYQTPPVSPPGPEGNLGPAPINQPGPANMLPPDLQPPPPAEPGTPQVAPSAFTPNGQKAPGLQVAKYDPRNGQYMGSDGTLYRQTNLAKPATTWQDMLQS

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
4 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
5 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
6 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
7 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
8 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
9 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
10 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
11 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
12 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
13 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
14 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
15 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
16 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
17 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
18 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
27 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
28 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
29 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
30 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
31 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
32 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
33 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
34 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
35 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
36 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
37 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
38 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
39 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
40 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
41 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
42 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
43 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
44 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
45 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
46 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
47 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
48 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
49 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
50 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
51 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
52 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
53 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
54 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
55 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
56 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
57 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
58 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
59 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
60 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
68 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
69 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
70 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
71 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
72 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
73 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
74 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
75 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
76 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
77 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
78 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
79 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
80 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
81 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
82 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
83 2547132424 Nocardia nova SH22a Isolate Unclassified
84 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
85 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
86 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
87 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
88 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.34
Metatranscriptomes 0
Isolates 9.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.03
Nodule 0
Rhizoplane 11.03
Rhizosphere 44.83
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100017791 3300005367 Bacteria 5891
2 Ga0070667_100093566 3300005367 Bacteria 2588
3 Ga0070714_100108000 3300005435 Bacteria 2460
4 Ga0070678_100018899 3300005456 Bacteria 4477
5 Ga0070665_100003751 3300005548 Bacteria 16089
6 Ga0068863_100008122 3300005841 Bacteria 10246
7 Ga0075365_10007800 3300006038 Bacteria 6027
8 Ga0075365_10043114 3300006038 Bacteria 2953
9 Ga0075365_10082907 3300006038 Bacteria 2175
10 Ga0075363_100000783 3300006048 Bacteria 10941
11 Ga0075364_10029425 3300006051 Bacteria 3522
12 Ga0075367_10024618 3300006178 Bacteria 3396
13 Ga0075369_10001081 3300006186 Bacteria 9134
14 Ga0075369_10020701 3300006186 Bacteria 2695
15 Ga0075369_10026743 3300006186 Bacteria 2407
16 Ga0075370_10048309 3300006353 Bacteria 2411
17 Ga0105247_10027179 3300009101 Bacteria 3460
18 Ga0105243_10056206 3300009148 Bacteria 3129
19 Ga0105248_10013677 3300009177 Bacteria 8933
20 Ga0157375_10097652 3300013308 Bacteria 3012
21 Ga0163163_10009820 3300014325 Bacteria 8576
22 Ga0213876_10006024 3300021384 Bacteria 6628
23 Ga0209051_1019385 3300025303 Bacteria 2969
24 Ga0207693_10079318 3300025915 Bacteria 2569
25 Ga0207664_10156820 3300025929 Bacteria 1939
26 Ga0207644_10058797 3300025931 Bacteria 2779
27 Ga0207669_10055136 3300025937 Bacteria 2405
28 Ga0207658_10028299 3300025986 Bacteria 3946
29 Ga0268266_10004127 3300028379 Bacteria 14036
30 Ga0268264_10122256 3300028381 Bacteria 2296
31 Ga0316578_10038668 3300031728 Bacteria 2753
32 Ga0307411_10097670 3300032005 Bacteria 2068
33 Ga0436364_0218929 3300037853 Bacteria 25746
34 Ga0436364_1001129 3300037853 Bacteria 6592
35 Ga0436365_0456575 3300039437 Bacteria 43610
36 Ga0436365_0680471 3300039437 Bacteria 5462
37 Ga0436363_0050858 3300039450 Bacteria 3821
38 Ga0439466_0016139 3300041411 Bacteria 2704
39 Ga0439465_0006333 3300041413 Bacteria 3760
40 Ga0439442_006972 3300042002 Bacteria 2270
41 Ga0466965_0026648 3300044683 Bacteria 2802
42 Ga0466965_0036575 3300044683 Bacteria 2409
43 Ga0466966_0001218 3300044684 Bacteria 16526
44 Ga0466966_0014978 3300044684 Bacteria 5130
45 Ga0466961_0014043 3300044693 Bacteria 5135
46 Ga0466963_0021884 3300044694 Bacteria 4041
47 Ga0466971_0004430 3300044719 Bacteria 6060
48 Ga0466968_0008850 3300044735 Bacteria 3863
49 Ga0466968_0011096 3300044735 Bacteria 3507
50 Ga0466970_0007380 3300044765 Bacteria 5508
51 Ga0466957_0008066 3300044842 Bacteria 5975
52 Ga0466957_0061826 3300044842 Bacteria 2300
53 Ga0466957_0063411 3300044842 Bacteria 2271
54 Ga0466960_0030549 3300044901 Bacteria 2480
55 Ga0466959_0001867 3300045049 Bacteria 13243
56 Ga0466959_0004377 3300045049 Bacteria 9452
57 Ga0466959_0006188 3300045049 Bacteria 8270
58 Ga0466959_0025204 3300045049 Bacteria 4406
59 Ga0466959_0027855 3300045049 Bacteria 4191
60 Ga0466958_0003868 3300045836 Bacteria 7832
61 Ga0466958_0006213 3300045836 Bacteria 6483
62 Ga0466967_0106750 3300045976 Bacteria 2567
63 Ga0495629_0007769 3300046459 Bacteria 7893
64 Ga0495638_0000503 3300046460 Bacteria 46384
65 Ga0495638_0001197 3300046460 Bacteria 24820
66 Ga0495638_0004360 3300046460 Bacteria 10718
67 Ga0495638_0009798 3300046460 Bacteria 6690
68 Ga0495638_0014364 3300046460 Bacteria 5356
69 Ga0495649_0040765 3300046694 Bacteria 2541
70 Ga0495674_0133546 3300047319 Bacteria 2090
71 Ga0495672_0002889 3300047320 Bacteria 15201
72 Ga0495672_0010888 3300047320 Bacteria 6452
73 Ga0495672_0019500 3300047320 Bacteria 4470
74 Ga0496100_0000991 3300048903 Bacteria 13672
75 Ga0496100_0004013 3300048903 Bacteria 7745
76 Ga0496101_0003475 3300048904 Bacteria 9828
77 Ga0496101_0006152 3300048904 Bacteria 7706
78 Ga0496102_0030211 3300048905 Bacteria 4849
79 Ga0496104_0002446 3300048907 Bacteria 15988
80 Ga0496104_0021750 3300048907 Bacteria 5890
81 Ga0496105_0032044 3300048908 Bacteria 4311
82 Ga0496106_0004255 3300048909 Bacteria 10655
83 Ga0496106_0006783 3300048909 Bacteria 8478
84 Ga0496107_0006342 3300048910 Bacteria 8131
85 Ga0496107_0009281 3300048910 Bacteria 6821
86 Ga0496114_0005339 3300048917 Bacteria 10043
87 Ga0496114_0005435 3300048917 Bacteria 9969
88 Ga0496115_0001799 3300048918 Bacteria 15359
89 Ga0496115_0004232 3300048918 Bacteria 10376
90 Ga0496126_0006823 3300048929 Bacteria 12667
91 Ga0501034_0120505 3300049571 Bacteria 2610
92 Ga0501037_0020715 3300049573 Bacteria 4855
93 Ga0501046_0003366 3300049580 Bacteria 14687
94 Ga0501047_0026079 3300049581 Bacteria 5620
95 Ga0501048_0053784 3300049582 Bacteria 2861
96 Ga0501035_0000556 3300049822 Bacteria 41478
97 Ga0501044_0000797 3300049823 Bacteria 38010
98 nmdc:mga00v17_11497_c1 3300050491 Bacteria 4864
99 nmdc:mga00v17_14248_c1 3300050491 Bacteria 4435
100 nmdc:mga0yw44_12202_c1 3300050492 Bacteria 4469
101 nmdc:mga06z11_55551_c1 3300050494 Bacteria 2045
102 nmdc:mga0sz30_10567_c1 3300050516 Bacteria 3540
103 nmdc:mga0sz30_2014_c1 3300050516 Bacteria 7260
104 nmdc:mga0sz30_20_c1 3300050516 Bacteria 61066
105 nmdc:mga0sz30_5032_c1 3300050516 Bacteria 4828
106 Ga0500610_0007902 3300053079 Bacteria 4597
107 Ga0500610_0035755 3300053079 Bacteria 2550
108 Ga0500610_0036015 3300053079 Bacteria 2543
109 Ga0500635_0006830 3300053080 Bacteria 3065
110 Ga0500635_0023108 3300053080 Bacteria 1936
111 Ga0500643_005185 3300053087 Bacteria 5677
112 Ga0500643_007224 3300053087 Bacteria 4522
113 Ga0500643_009242 3300053087 Bacteria 3782
114 Ga0500556_0001777 3300053104 Bacteria 8033
115 Ga0500556_0003102 3300053104 Bacteria 4960
116 Ga0500562_001190 3300053108 Bacteria 6407
117 Ga0500652_000353 3300053131 Bacteria 16458
118 Ga0500652_000556 3300053131 Bacteria 12999
119 Ga0500652_000779 3300053131 Bacteria 10705
120 Ga0500652_001491 3300053131 Bacteria 7204
121 Ga0500561_0016617 3300053137 Bacteria 1655
122 Ga0500616_0002810 3300053153 Bacteria 14008
123 Ga0500616_0003351 3300053153 Bacteria 12325
124 Ga0500616_0003900 3300053153 Bacteria 10973
125 Ga0500627_0028662 3300053158 Bacteria 2315
126 Ga0500645_000013 3300053730 Bacteria 154598
127 Ga0500645_000063 3300053730 Bacteria 85018
128 Ga0500645_000121 3300053730 Bacteria 61869
129 Ga0500645_003230 3300053730 Bacteria 6744
130 Ga0500645_004180 3300053730 Bacteria 5620
131 Ga0500645_010481 3300053730 Unclassified 3063
132 2902800077 2902799365 Bacteria 5419524
133 2548693644 2547132424 Bacteria 8348532
134 2738706156 2738541274 Bacteria 6909446
135 2738706659 2738541274 Bacteria 6909446
136 2738707788 2738541274 Bacteria 6909446
137 2738708299 2738541274 Bacteria 6909446
138 2739331968 2738543028 Bacteria 6917070
139 2739331996 2738543028 Bacteria 6917070
140 2739332944 2738543028 Bacteria 6917070
141 2739334128 2738543028 Bacteria 6917070
142 2744958058 2744054611 Bacteria 5611514
143 2902802062 2902799365 Bacteria 5419524
144 2902843290 2902837492 Bacteria 6697721
145 2919719128 2919713450 Bacteria 7431245
146 Ga0070667_100017791
147 Ga0070667_100093566
148 Ga0070714_100108000
149 Ga0070678_100018899
150 Ga0070665_100003751
151 Ga0068863_100008122
152 Ga0075365_10007800
153 Ga0075365_10043114
154 Ga0075365_10082907
155 Ga0075363_100000783
156 Ga0075364_10029425
157 Ga0075367_10024618
158 Ga0075369_10001081
159 Ga0075369_10020701
160 Ga0075369_10026743
161 Ga0075370_10048309
162 Ga0105247_10027179
163 Ga0105243_10056206
164 Ga0105248_10013677
165 Ga0157375_10097652
166 Ga0163163_10009820
167 Ga0213876_10006024
168 Ga0209051_1019385
169 Ga0207693_10079318
170 Ga0207664_10156820
171 Ga0207644_10058797
172 Ga0207669_10055136
173 Ga0207658_10028299
174 Ga0268266_10004127
175 Ga0268264_10122256
176 Ga0316578_10038668
177 Ga0307411_10097670
178 Ga0436364_0218929
179 Ga0436364_1001129
180 Ga0436365_0456575
181 Ga0436365_0680471
182 Ga0436363_0050858
183 Ga0439466_0016139
184 Ga0439465_0006333
185 Ga0439442_006972
186 Ga0466965_0026648
187 Ga0466965_0036575
188 Ga0466966_0001218
189 Ga0466966_0014978
190 Ga0466961_0014043
191 Ga0466963_0021884
192 Ga0466971_0004430
193 Ga0466968_0008850
194 Ga0466968_0011096
195 Ga0466970_0007380
196 Ga0466957_0008066
197 Ga0466957_0061826
198 Ga0466957_0063411
199 Ga0466960_0030549
200 Ga0466959_0001867
201 Ga0466959_0004377
202 Ga0466959_0006188
203 Ga0466959_0025204
204 Ga0466959_0027855
205 Ga0466958_0003868
206 Ga0466958_0006213
207 Ga0466967_0106750
208 Ga0495629_0007769
209 Ga0495638_0000503
210 Ga0495638_0001197
211 Ga0495638_0004360
212 Ga0495638_0009798
213 Ga0495638_0014364
214 Ga0495649_0040765
215 Ga0495674_0133546
216 Ga0495672_0002889
217 Ga0495672_0010888
218 Ga0495672_0019500
219 Ga0496100_0000991
220 Ga0496100_0004013
221 Ga0496101_0003475
222 Ga0496101_0006152
223 Ga0496102_0030211
224 Ga0496104_0002446
225 Ga0496104_0021750
226 Ga0496105_0032044
227 Ga0496106_0004255
228 Ga0496106_0006783
229 Ga0496107_0006342
230 Ga0496107_0009281
231 Ga0496114_0005339
232 Ga0496114_0005435
233 Ga0496115_0001799
234 Ga0496115_0004232
235 Ga0496126_0006823
236 Ga0501034_0120505
237 Ga0501037_0020715
238 Ga0501046_0003366
239 Ga0501047_0026079
240 Ga0501048_0053784
241 Ga0501035_0000556
242 Ga0501044_0000797
243 nmdc:mga00v17_11497_c1
244 nmdc:mga00v17_14248_c1
245 nmdc:mga0yw44_12202_c1
246 nmdc:mga06z11_55551_c1
247 nmdc:mga0sz30_10567_c1
248 nmdc:mga0sz30_2014_c1
249 nmdc:mga0sz30_20_c1
250 nmdc:mga0sz30_5032_c1
251 Ga0500610_0007902
252 Ga0500610_0035755
253 Ga0500610_0036015
254 Ga0500635_0006830
255 Ga0500635_0023108
256 Ga0500643_005185
257 Ga0500643_007224
258 Ga0500643_009242
259 Ga0500556_0001777
260 Ga0500556_0003102
261 Ga0500562_001190
262 Ga0500652_000353
263 Ga0500652_000556
264 Ga0500652_000779
265 Ga0500652_001491
266 Ga0500561_0016617
267 Ga0500616_0002810
268 Ga0500616_0003351
269 Ga0500616_0003900
270 Ga0500627_0028662
271 Ga0500645_000013
272 Ga0500645_000063
273 Ga0500645_000121
274 Ga0500645_003230
275 Ga0500645_004180
276 Ga0500645_010481
277 2902800077
278 2548693644
279 2738706156
280 2738706659
281 2738707788
282 2738708299
283 2739331968
284 2739331996
285 2739332944
286 2739334128
287 2744958058
288 2902802062
289 2902843290
290 2919719128

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02470

MlaD

MlaD protein

34

110

0.96

PF11887

Mce4_CUP1

Cholesterol uptake porter CUP1 of Mce4, putative

113

301

0.95

Map