F195596

General Info

Members Datasets Scaffolds Average Seq Length
145 108 145 194

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0000752|Ga0495606_0000752_22191_22838
Length 215
Sequence MSKRTRGAEAYEAEAPEGRPNADHREGAKTNRITAMSHPLRARILRLLFERDVMSPAQLSRELRAELSDVSYHVRALVKLECAEEVSSRPVRGALEHFYRAIERPLIDTDEFEELDPVTAEDLLCQAIQRILDDFVDSRQAKMVGYDKNFHVSRTPLILDEEGYEEGMQAFERCRRELSEIEQKSAERRAESGAPGIATSGDLLFFKMPSASLGN

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
84 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
85 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
91 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
106 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
107 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
108 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.24
Metatranscriptomes 2.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.03
Rhizosphere 86.9
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10103778 3300003316 Bacteria 1979
2 Ga0058860_10963062 3300004801 Unclassified 783
3 Ga0070658_10277454 3300005327 Bacteria 1426
4 Ga0070683_100000175 3300005329 Bacteria 42458
5 Ga0070683_100009440 3300005329 Bacteria 8344
6 Ga0070670_100781728 3300005331 Bacteria 861
7 Ga0070666_10056798 3300005335 Bacteria 2644
8 Ga0070682_100000026 3300005337 Bacteria 191388
9 Ga0070660_100083582 3300005339 Bacteria 2508
10 Ga0070689_100627266 3300005340 Unclassified 933
11 Ga0070668_100004525 3300005347 Bacteria 10315
12 Ga0070675_100000070 3300005354 Bacteria 59599
13 Ga0070688_100000028 3300005365 Bacteria 67085
14 Ga0070688_100042414 3300005365 Bacteria 2799
15 Ga0070659_100869285 3300005366 Unclassified 787
16 Ga0070667_100001487 3300005367 Bacteria 21007
17 Ga0070667_100036377 3300005367 Bacteria 4128
18 Ga0070713_100000005 3300005436 Bacteria 201526
19 Ga0070713_100161618 3300005436 Bacteria 2000
20 Ga0070711_100125946 3300005439 Bacteria 1901
21 Ga0070685_10000027 3300005466 Bacteria 91882
22 Ga0070685_10264946 3300005466 Bacteria 1144
23 Ga0070684_100005164 3300005535 Bacteria 9982
24 Ga0070684_100008294 3300005535 Bacteria 8116
25 Ga0068853_100541335 3300005539 Unclassified 1102
26 Ga0070672_100000031 3300005543 Bacteria 62241
27 Ga0070686_100144203 3300005544 Bacteria 1661
28 Ga0070686_100228683 3300005544 Bacteria 1348
29 Ga0070665_100001275 3300005548 Bacteria 30231
30 Ga0070665_100059837 3300005548 Bacteria 3818
31 Ga0070665_100089834 3300005548 Bacteria 3078
32 Ga0068855_100077298 3300005563 Bacteria 3862
33 Ga0068854_100000268 3300005578 Bacteria 35449
34 Ga0068854_100413148 3300005578 Bacteria 1119
35 Ga0068856_100000136 3300005614 Bacteria 74026
36 Ga0068856_100018065 3300005614 Bacteria 6839
37 Ga0068852_100000104 3300005616 Bacteria 56243
38 Ga0068852_100121044 3300005616 Bacteria 2396
39 Ga0068851_10001393 3300005834 Bacteria 10561
40 Ga0068862_100001555 3300005844 Bacteria 20982
41 Ga0081455_10008871 3300005937 Bacteria 10397
42 Ga0070712_100004570 3300006175 Bacteria 8547
43 Ga0097621_100767707 3300006237 Unclassified 891
44 Ga0068865_100000040 3300006881 Bacteria 72979
45 Ga0075436_100338378 3300006914 Unclassified 1083
46 Ga0105245_10000117 3300009098 Bacteria 76863
47 Ga0105245_10003267 3300009098 Bacteria 14544
48 Ga0105247_10274111 3300009101 Bacteria 1161
49 Ga0105247_10292558 3300009101 Bacteria 1127
50 Ga0105248_10000037 3300009177 Bacteria 180751
51 Ga0105249_10013030 3300009553 Bacteria 7338
52 Ga0105239_10216160 3300010375 Bacteria 2149
53 Ga0105239_10504720 3300010375 Bacteria 1375
54 Ga0157371_10004648 3300013102 Bacteria 11895
55 Ga0157370_10069707 3300013104 Bacteria 3320
56 Ga0157370_10385575 3300013104 Unclassified 1291
57 Ga0157369_10000051 3300013105 Bacteria 165672
58 Ga0157378_10001694 3300013297 Bacteria 19848
59 Ga0157378_10006192 3300013297 Bacteria 10469
60 Ga0157372_10000146 3300013307 Bacteria 77952
61 Ga0157380_10000007 3300014326 Bacteria 157634
62 Ga0157380_10000169 3300014326 Bacteria 37727
63 Ga0157379_10063816 3300014968 Bacteria 3292
64 Ga0157376_10530584 3300014969 Unclassified 1162
65 Ga0206356_10121768 3300020070 Bacteria 3049
66 Ga0154015_1393571 3300020610 Bacteria 1277
67 Ga0224712_10157426 3300022467 Bacteria 1011
68 Ga0207680_10002080 3300025903 Bacteria 9381
69 Ga0207705_10072438 3300025909 Bacteria 2499
70 Ga0207693_10011863 3300025915 Bacteria 7044
71 Ga0207663_10174020 3300025916 Bacteria 1532
72 Ga0207657_10181441 3300025919 Bacteria 1701
73 Ga0207650_10031474 3300025925 Bacteria 3831
74 Ga0207659_10000018 3300025926 Bacteria 156920
75 Ga0207687_10000070 3300025927 Bacteria 77432
76 Ga0207687_10337494 3300025927 Unclassified 1224
77 Ga0207700_10000003 3300025928 Bacteria 500797
78 Ga0207700_10154830 3300025928 Bacteria 1898
79 Ga0207664_10390438 3300025929 Bacteria 1237
80 Ga0207690_10644792 3300025932 Unclassified 867
81 Ga0207704_10000079 3300025938 Bacteria 58183
82 Ga0207691_10000178 3300025940 Bacteria 60110
83 Ga0207661_10000121 3300025944 Bacteria 50040
84 Ga0207661_10000239 3300025944 Bacteria 36056
85 Ga0207667_10253857 3300025949 Bacteria 1799
86 Ga0207712_10032261 3300025961 Bacteria 3535
87 Ga0207668_10022889 3300025972 Bacteria 4006
88 Ga0207640_10000054 3300025981 Bacteria 95136
89 Ga0207658_10011906 3300025986 Bacteria 5930
90 Ga0207639_10593837 3300026041 Unclassified 1020
91 Ga0207702_10000202 3300026078 Bacteria 70333
92 Ga0207698_10000015 3300026142 Bacteria 207368
93 Ga0207698_10002679 3300026142 Bacteria 10595
94 Ga0268266_10001389 3300028379 Bacteria 29082
95 Ga0268266_10062351 3300028379 Bacteria 3218
96 Ga0268266_10064658 3300028379 Bacteria 3161
97 Ga0268265_10002741 3300028380 Bacteria 13001
98 Ga0466963_0057345 3300044694 Bacteria 2594
99 Ga0466957_0013988 3300044842 Bacteria 4667
100 Ga0466958_0171877 3300045836 Bacteria 1372
101 Ga0466967_0000002 3300045976 Bacteria 219994
102 Ga0495629_0000988 3300046459 Bacteria 22791
103 Ga0495606_0000017 3300046507 Bacteria 284549
104 Ga0495606_0000752 3300046507 Bacteria 50099
105 Ga0495608_0000013 3300046511 Bacteria 228481
106 Ga0495630_0000032 3300046517 Bacteria 134425
107 Ga0495625_0511571 3300046660 Bacteria 733
108 Ga0495588_0000073 3300046674 Bacteria 219005
109 Ga0495657_0000003 3300046675 Bacteria 279680
110 Ga0495647_0000423 3300046681 Bacteria 12093
111 Ga0495658_0019126 3300046683 Bacteria 3571
112 Ga0495613_0000027 3300046689 Bacteria 146674
113 Ga0495624_0000761 3300046690 Bacteria 25413
114 Ga0495600_0010892 3300046809 Bacteria 5656
115 Ga0495604_0000058 3300047317 Bacteria 96955
116 Ga0495604_0121776 3300047317 Bacteria 1887
117 Ga0495672_0061060 3300047320 Bacteria 2174
118 Ga0495672_0126716 3300047320 Unclassified 1349
119 Ga0495676_0050181 3300047321 Bacteria 3348
120 Ga0495675_0000002 3300047444 Bacteria 216469
121 Ga0495602_0000034 3300048088 Bacteria 140722
122 Ga0496102_0538106 3300048905 Bacteria 1091
123 Ga0496104_0029016 3300048907 Bacteria 5130
124 Ga0496108_0000005 3300048911 Bacteria 535059
125 Ga0496108_0385107 3300048911 Bacteria 1224
126 Ga0496109_0000002 3300048912 Bacteria 443393
127 Ga0496109_0000066 3300048912 Bacteria 112004
128 Ga0496110_0000077 3300048913 Bacteria 50609
129 Ga0496110_0011960 3300048913 Bacteria 7129
130 Ga0496110_0043973 3300048913 Unclassified 3900
131 Ga0496110_0382058 3300048913 Bacteria 1283
132 Ga0496111_0000137 3300048914 Bacteria 32511
133 Ga0496111_0061925 3300048914 Unclassified 2713
134 Ga0496111_0191162 3300048914 Bacteria 1522
135 Ga0496112_0000868 3300048915 Bacteria 21645
136 Ga0496113_0000005 3300048916 Bacteria 105956
137 Ga0496114_0153079 3300048917 Unclassified 2001
138 Ga0496124_0128528 3300048927 Bacteria 2016
139 nmdc:mga08x19_286924_c1 3300050514 Unclassified 1141
140 Ga0495601_0000017 3300053077 Bacteria 204209
141 Ga0495601_0313235 3300053077 Bacteria 1022
142 Ga0495595_0000007 3300053084 Bacteria 228504
143 Ga0495595_0032170 3300053084 Bacteria 2361
144 Ga0495619_0000026 3300053085 Bacteria 167387
145 Ga0495619_0000096 3300053085 Bacteria 66203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0061060 Ga0495672_0061060_559_1140 168
2 3300005347 Ga0070668_100004525 Ga0070668_10000452515 174
3 3300005367 Ga0070667_100001487 Ga0070667_1000014878 174
4 3300005844 Ga0068862_100001555 Ga0068862_10000155518 174
5 3300005937 Ga0081455_10008871 Ga0081455_1000887113 174
6 3300009101 Ga0105247_10292558 Ga0105247_102925582 174
7 3300009553 Ga0105249_10013030 Ga0105249_100130302 174
8 3300014968 Ga0157379_10063816 Ga0157379_100638163 174
9 3300025961 Ga0207712_10032261 Ga0207712_100322613 174
10 3300025972 Ga0207668_10022889 Ga0207668_100228896 174
11 3300025986 Ga0207658_10011906 Ga0207658_100119066 174
12 3300028380 Ga0268265_10002741 Ga0268265_100027418 174
13 3300048905 Ga0496102_0538106 Ga0496102_0538106_400_981 174
14 3300048913 Ga0496110_0382058 Ga0496110_0382058_662_1243 174
15 3300048914 Ga0496111_0191162 Ga0496111_0191162_10_591 174
16 3300005539 Ga0068853_100541335 Ga0068853_1005413352 181
17 3300026041 Ga0207639_10593837 Ga0207639_105938372 181
18 3300005548 Ga0070665_100059837 Ga0070665_1000598373 192
19 3300028379 Ga0268266_10062351 Ga0268266_100623512 192
20 3300005329 Ga0070683_100000175 Ga0070683_10000017538 193
21 3300005535 Ga0070684_100005164 Ga0070684_1000051642 193
22 3300013297 Ga0157378_10001694 Ga0157378_1000169411 193
23 3300025944 Ga0207661_10000121 Ga0207661_1000012125 193
24 3300005327 Ga0070658_10277454 Ga0070658_102774542 195
25 3300005335 Ga0070666_10056798 Ga0070666_100567984 195
26 3300005337 Ga0070682_100000026 Ga0070682_100000026107 195
27 3300005339 Ga0070660_100083582 Ga0070660_1000835824 195
28 3300005340 Ga0070689_100627266 Ga0070689_1006272661 195
29 3300005354 Ga0070675_100000070 Ga0070675_10000007057 195
30 3300005365 Ga0070688_100042414 Ga0070688_1000424144 195
31 3300005366 Ga0070659_100869285 Ga0070659_1008692851 195
32 3300005367 Ga0070667_100036377 Ga0070667_1000363775 195
33 3300005436 Ga0070713_100000005 Ga0070713_10000000542 195
34 3300005436 Ga0070713_100161618 Ga0070713_1001616183 195
35 3300005439 Ga0070711_100125946 Ga0070711_1001259462 195
36 3300005466 Ga0070685_10264946 Ga0070685_102649461 195
37 3300005543 Ga0070672_100000031 Ga0070672_10000003116 195
38 3300005544 Ga0070686_100144203 Ga0070686_1001442032 195
39 3300005544 Ga0070686_100228683 Ga0070686_1002286832 195
40 3300005548 Ga0070665_100001275 Ga0070665_10000127510 195
41 3300005548 Ga0070665_100089834 Ga0070665_1000898343 195
42 3300005563 Ga0068855_100077298 Ga0068855_1000772983 195
43 3300005578 Ga0068854_100000268 Ga0068854_10000026834 195
44 3300005578 Ga0068854_100413148 Ga0068854_1004131482 195
45 3300005616 Ga0068852_100121044 Ga0068852_1001210442 195
46 3300005834 Ga0068851_10001393 Ga0068851_1000139310 195
47 3300006914 Ga0075436_100338378 Ga0075436_1003383782 195
48 3300009098 Ga0105245_10003267 Ga0105245_100032672 195
49 3300010375 Ga0105239_10216160 Ga0105239_102161603 195
50 3300013104 Ga0157370_10385575 Ga0157370_103855751 195
51 3300013297 Ga0157378_10006192 Ga0157378_100061929 195
52 3300013307 Ga0157372_10000146 Ga0157372_1000014662 195
53 3300014326 Ga0157380_10000007 Ga0157380_1000000775 195
54 3300014969 Ga0157376_10530584 Ga0157376_105305842 195
55 3300025903 Ga0207680_10002080 Ga0207680_100020802 195
56 3300025909 Ga0207705_10072438 Ga0207705_100724384 195
57 3300025916 Ga0207663_10174020 Ga0207663_101740202 195
58 3300025919 Ga0207657_10181441 Ga0207657_101814412 195
59 3300025926 Ga0207659_10000018 Ga0207659_100000187 195
60 3300025927 Ga0207687_10337494 Ga0207687_103374941 195
61 3300025928 Ga0207700_10000003 Ga0207700_10000003232 195
62 3300025928 Ga0207700_10154830 Ga0207700_101548303 195
63 3300025932 Ga0207690_10644792 Ga0207690_106447922 195
64 3300025940 Ga0207691_10000178 Ga0207691_1000017869 195
65 3300025949 Ga0207667_10253857 Ga0207667_102538573 195
66 3300025981 Ga0207640_10000054 Ga0207640_1000005484 195
67 3300026142 Ga0207698_10002679 Ga0207698_100026799 195
68 3300028379 Ga0268266_10001389 Ga0268266_100013899 195
69 3300028379 Ga0268266_10064658 Ga0268266_100646583 195
70 3300045976 Ga0466967_0000002 Ga0466967_0000002_85571_86158 195
71 3300046459 Ga0495629_0000988 Ga0495629_0000988_1226_1813 195
72 3300046507 Ga0495606_0000017 Ga0495606_0000017_86669_87256 195
73 3300046511 Ga0495608_0000013 Ga0495608_0000013_34568_35155 195
74 3300046517 Ga0495630_0000032 Ga0495630_0000032_111224_111811 195
75 3300046660 Ga0495625_0511571 Ga0495625_0511571_74_661 195
76 3300046674 Ga0495588_0000073 Ga0495588_0000073_138597_139184 195
77 3300046675 Ga0495657_0000003 Ga0495657_0000003_85767_86354 195
78 3300046681 Ga0495647_0000423 Ga0495647_0000423_11381_11968 195
79 3300046690 Ga0495624_0000761 Ga0495624_0000761_8468_9055 195
80 3300046809 Ga0495600_0010892 Ga0495600_0010892_1674_2261 195
81 3300047317 Ga0495604_0000058 Ga0495604_0000058_84442_85029 195
82 3300047317 Ga0495604_0121776 Ga0495604_0121776_48_635 195
83 3300047320 Ga0495672_0126716 Ga0495672_0126716_564_1151 195
84 3300047321 Ga0495676_0050181 Ga0495676_0050181_2142_2729 195
85 3300047444 Ga0495675_0000002 Ga0495675_0000002_85767_86354 195
86 3300048088 Ga0495602_0000034 Ga0495602_0000034_137674_138261 195
87 3300048907 Ga0496104_0029016 Ga0496104_0029016_3688_4275 195
88 3300048913 Ga0496110_0000077 Ga0496110_0000077_20045_20632 195
89 3300048913 Ga0496110_0043973 Ga0496110_0043973_1073_1660 195
90 3300048914 Ga0496111_0000137 Ga0496111_0000137_18755_19342 195
91 3300048914 Ga0496111_0061925 Ga0496111_0061925_1433_2020 195
92 3300048915 Ga0496112_0000868 Ga0496112_0000868_4127_4714 195
93 3300048916 Ga0496113_0000005 Ga0496113_0000005_36594_37181 195
94 3300048917 Ga0496114_0153079 Ga0496114_0153079_1238_1825 195
95 3300050514 nmdc:mga08x19_286924_c1 nmdc:mga08x19_286924_c1_61_648 195
96 3300053077 Ga0495601_0000017 Ga0495601_0000017_59100_59687 195
97 3300053077 Ga0495601_0313235 Ga0495601_0313235_166_753 195
98 3300053084 Ga0495595_0000007 Ga0495595_0000007_34591_35178 195
99 3300053084 Ga0495595_0032170 Ga0495595_0032170_790_1377 195
100 3300053085 Ga0495619_0000026 Ga0495619_0000026_137386_137973 195
101 3300053085 Ga0495619_0000096 Ga0495619_0000096_46108_46695 195
102 3300009101 Ga0105247_10274111 Ga0105247_102741112 196
103 3300013104 Ga0157370_10069707 Ga0157370_100697075 196
104 3300014326 Ga0157380_10000169 Ga0157380_1000016913 196
105 3300020070 Ga0206356_10121768 Ga0206356_101217682 196
106 3300046507 Ga0495606_0000752 Ga0495606_0000752_22191_22838 196
107 3300048913 Ga0496110_0011960 Ga0496110_0011960_4087_4722 196
108 3300048927 Ga0496124_0128528 Ga0496124_0128528_19_654 196
109 3300020610 Ga0154015_1393571 Ga0154015_13935712 197
110 3300025929 Ga0207664_10390438 Ga0207664_103904382 197
111 3300045836 Ga0466958_0171877 Ga0466958_0171877_679_1272 197
112 3300048911 Ga0496108_0385107 Ga0496108_0385107_152_745 197
113 3300048912 Ga0496109_0000066 Ga0496109_0000066_33238_33831 197
114 3300003316 rootH1_10103778 rootH1_101037782 198
115 3300004801 Ga0058860_10963062 Ga0058860_109630621 198
116 3300005329 Ga0070683_100009440 Ga0070683_10000944010 198
117 3300005331 Ga0070670_100781728 Ga0070670_1007817281 198
118 3300005365 Ga0070688_100000028 Ga0070688_10000002820 198
119 3300005466 Ga0070685_10000027 Ga0070685_1000002773 198
120 3300005535 Ga0070684_100008294 Ga0070684_1000082944 198
121 3300005614 Ga0068856_100000136 Ga0068856_10000013635 198
122 3300005614 Ga0068856_100018065 Ga0068856_1000180654 198
123 3300005616 Ga0068852_100000104 Ga0068852_10000010429 198
124 3300006175 Ga0070712_100004570 Ga0070712_1000045708 198
125 3300006237 Ga0097621_100767707 Ga0097621_1007677071 198
126 3300006881 Ga0068865_100000040 Ga0068865_10000004051 198
127 3300009098 Ga0105245_10000117 Ga0105245_1000011755 198
128 3300009177 Ga0105248_10000037 Ga0105248_10000037113 198
129 3300010375 Ga0105239_10504720 Ga0105239_105047202 198
130 3300013102 Ga0157371_10004648 Ga0157371_1000464815 198
131 3300013105 Ga0157369_10000051 Ga0157369_10000051122 198
132 3300022467 Ga0224712_10157426 Ga0224712_101574262 198
133 3300025915 Ga0207693_10011863 Ga0207693_100118631 198
134 3300025925 Ga0207650_10031474 Ga0207650_100314744 198
135 3300025927 Ga0207687_10000070 Ga0207687_1000007040 198
136 3300025938 Ga0207704_10000079 Ga0207704_1000007915 198
137 3300025944 Ga0207661_10000239 Ga0207661_100002392 198
138 3300026078 Ga0207702_10000202 Ga0207702_1000020249 198
139 3300026142 Ga0207698_10000015 Ga0207698_1000001556 198
140 3300044694 Ga0466963_0057345 Ga0466963_0057345_694_1290 198
141 3300044842 Ga0466957_0013988 Ga0466957_0013988_427_1023 198
142 3300046683 Ga0495658_0019126 Ga0495658_0019126_2703_3299 198
143 3300046689 Ga0495613_0000027 Ga0495613_0000027_87168_87767 198
144 3300048911 Ga0496108_0000005 Ga0496108_0000005_386374_386970 198
145 3300048912 Ga0496109_0000002 Ga0496109_0000002_148122_148718 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

36

81

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

38

84

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x4h-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9598 35 67
3r61-assembly1.cif.gz_B structure of the mntr co2+ complex 0.9207 35 65
3k2z-assembly1.cif.gz_B crystal structure of a lexa protein from thermotoga maritima 0.9177 35 65
4hx7-assembly1.cif.gz_A structure of mntr e11k mutant complexed with cd2+ 0.9142 35 65
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9118 34 82
ID Description Score Start End Superfamily
2x4hA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9706 35 68 1.10.10.10
1ulyA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9483 15 83 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9437 20 83 1.10.10.10
2ev5A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.932 35 64 1.10.10.10
3r61B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9207 35 65 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A846NI75-F1-model_v4 S-layer protein 0.971 15 84 GO:0005509
AF-A0A7J3DNC3-F1-model_v4 ArsR family transcriptional regulator 0.9695 15 85 GO:0003700
AF-A0A2D5XYU3-F1-model_v4 S-layer protein outer domain-containing protein 0.9671 15 83
AF-A0A7J2TY81-F1-model_v4 ArsR family transcriptional regulator 0.9595 15 82 GO:0003700
AF-A0A1F3BHR2-F1-model_v4 S-layer protein outer domain-containing protein 0.959 16 85

Feature Viewer

pLDDT pTM Quality
77.68 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map