F194036

General Info

Members Datasets Scaffolds Average Seq Length
145 105 145 535

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100006274|Ga0070698_10000627410
Length 596
Sequence VSTASTKSSNKQANRGKASTSGTRRIDQATAALPETVIDERTWFIAVTAILLLGAILRLYNLDLVPLHHDEGVNGNFLVRLVREGYYHYDPANYHGPTLYYFAAVVAWILRPFVGANASLTTTGIRLVPALFGLATIGLVFTLRRNLGTIATLGAAFLLAISPGAVYLSRYFIHETLFVFFTLGLVVALIKYFEGLNPAYLILAAISAALLFATKETAMISVAVLLIALVVTKVYRLLLRSLGVTPNQKKGRTDDYRTFFEKVGGSSKLTVWLVTAFAVFVGTYVLFYSSFFTNYPQGIYDSLKTFQFWTKTGQEAHKHPAATYIWWLLQQESPLLVLGAMGAIIAVLKPTRSFALFSALWAFGLIAAYSLIAYKTPWLSLNFIVPLAVVSGVAIDWFYEELGRWEMTRRLRWYALAVLLLLAIGPLPGFARIFDDVAFKASSENYTGLGEIEIHKKTFIPGYQTIDLNFLNYDNDNRYYXXXXAHTRRETLKLLEEIDKVAERTHQGKETGITIVSADYWPLPWYLRDYKRVGYHGHMTPSNEPIIIARQDQAEEALTTFGDRYQQIQSGFNTAGSFPLRPGVDLLLYTRRELVR

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
83 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
84 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
85 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
86 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
87 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
94 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
97 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
98 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
99 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
100 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
101 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
105 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.14
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3492608 2162886011 Bacteria 1688
2 JGI25406J46586_10007979 3300003203 Bacteria 4815
3 Ga0065714_10064424 3300005288 Bacteria 236118
4 Ga0065712_10000117 3300005290 Bacteria 235194
5 Ga0065712_10007022 3300005290 Unclassified 2982
6 Ga0065712_10019385 3300005290 Unclassified 2242
7 Ga0065715_10006326 3300005293 Unclassified 3256
8 Ga0070670_100138689 3300005331 Unclassified 2103
9 Ga0068869_100066596 3300005334 Bacteria 2654
10 Ga0068869_100105106 3300005334 Bacteria 2141
11 Ga0070680_100090328 3300005336 Bacteria 2535
12 Ga0070682_100000254 3300005337 Bacteria 38669
13 Ga0070692_10041641 3300005345 Bacteria 2354
14 Ga0070703_10001897 3300005406 Bacteria 6149
15 Ga0070700_100000174 3300005441 Bacteria 36209
16 Ga0070694_100015083 3300005444 Bacteria 4844
17 Ga0070708_100205594 3300005445 Bacteria 1844
18 Ga0070681_10035395 3300005458 Bacteria 5016
19 Ga0070706_100000146 3300005467 Bacteria 89818
20 Ga0070706_100004910 3300005467 Bacteria 12797
21 Ga0070706_100046191 3300005467 Bacteria 4020
22 Ga0070698_100006274 3300005471 Bacteria 12920
23 Ga0070698_100009864 3300005471 Bacteria 10209
24 Ga0070679_100015138 3300005530 Bacteria 7412
25 Ga0070684_100092770 3300005535 Bacteria 2687
26 Ga0070697_100002516 3300005536 Bacteria 14106
27 Ga0070697_100008906 3300005536 Bacteria 7839
28 Ga0070686_100025260 3300005544 Bacteria 3573
29 Ga0070695_100016288 3300005545 Bacteria 4497
30 Ga0070695_100033050 3300005545 Unclassified 3236
31 Ga0070695_100105475 3300005545 Unclassified 1905
32 Ga0070696_100004388 3300005546 Bacteria 9407
33 Ga0070696_100021688 3300005546 Unclassified 4356
34 Ga0070693_100025317 3300005547 Bacteria 3193
35 Ga0070693_100041359 3300005547 Unclassified 2592
36 Ga0070693_100078222 3300005547 Bacteria 1965
37 Ga0070704_100091091 3300005549 Unclassified 2273
38 Ga0068852_100035721 3300005616 Bacteria 4149
39 Ga0068859_100007171 3300005617 Bacteria 11317
40 Ga0068859_100019623 3300005617 Bacteria 6791
41 Ga0068859_100058732 3300005617 Unclassified 3875
42 Ga0068859_100205335 3300005617 Bacteria 2055
43 Ga0068861_100088729 3300005719 Bacteria 2436
44 Ga0068863_100057152 3300005841 Bacteria 3692
45 Ga0068863_100086461 3300005841 Unclassified 2971
46 Ga0068858_100041062 3300005842 Bacteria 4290
47 Ga0068858_100056143 3300005842 Bacteria 3640
48 Ga0068862_100046433 3300005844 Bacteria 3706
49 Ga0081539_10000395 3300005985 Bacteria 93818
50 Ga0081539_10002723 3300005985 Bacteria 23909
51 Ga0070717_10079247 3300006028 Unclassified 2754
52 Ga0075428_100021649 3300006844 Bacteria 7117
53 Ga0075431_100033481 3300006847 Bacteria 5295
54 Ga0075433_10065748 3300006852 Bacteria 3181
55 Ga0075429_100012520 3300006880 Bacteria 7359
56 Ga0097620_100007169 3300006931 Bacteria 11317
57 Ga0097620_100019623 3300006931 Bacteria 6791
58 Ga0097620_100058735 3300006931 Unclassified 3875
59 Ga0097620_100205325 3300006931 Bacteria 2055
60 Ga0105240_10014704 3300009093 Bacteria 10675
61 Ga0105240_10076523 3300009093 Unclassified 4125
62 Ga0105247_10015232 3300009101 Bacteria 4610
63 Ga0114129_10046982 3300009147 Bacteria 6067
64 Ga0114129_10316938 3300009147 Bacteria 2074
65 Ga0105243_10008050 3300009148 Bacteria 8094
66 Ga0105241_10037439 3300009174 Bacteria 3654
67 Ga0105241_10084660 3300009174 Bacteria 2490
68 Ga0105242_10054694 3300009176 Bacteria 3263
69 Ga0105248_10032086 3300009177 Bacteria 5870
70 Ga0105248_10036215 3300009177 Bacteria 5518
71 Ga0105248_10048666 3300009177 Bacteria 4755
72 Ga0105248_10216438 3300009177 Bacteria 2157
73 Ga0105237_10003746 3300009545 Bacteria 17911
74 Ga0105237_10040845 3300009545 Bacteria 4678
75 Ga0105238_10010644 3300009551 Bacteria 9240
76 Ga0105238_10048752 3300009551 Bacteria 4267
77 Ga0105249_10010660 3300009553 Bacteria 8074
78 Ga0157373_10000717 3300013100 Bacteria 25952
79 Ga0157373_10043846 3300013100 Unclassified 3194
80 Ga0157378_10025765 3300013297 Bacteria 5181
81 Ga0163162_10065531 3300013306 Bacteria 3680
82 Ga0157372_10007251 3300013307 Bacteria 11810
83 Ga0163163_10221838 3300014325 Bacteria 1939
84 Ga0163163_10233923 3300014325 Bacteria 1887
85 Ga0157379_10005500 3300014968 Bacteria 10881
86 Ga0207653_10008163 3300025885 Bacteria 3263
87 Ga0207710_10007033 3300025900 Bacteria 4781
88 Ga0207643_10000583 3300025908 Bacteria 23140
89 Ga0207684_10001620 3300025910 Bacteria 23885
90 Ga0207684_10024231 3300025910 Bacteria 5176
91 Ga0207654_10054848 3300025911 Bacteria 2305
92 Ga0207695_10047582 3300025913 Bacteria 4537
93 Ga0207671_10011699 3300025914 Bacteria 7113
94 Ga0207671_10024054 3300025914 Bacteria 4585
95 Ga0207660_10041153 3300025917 Unclassified 3237
96 Ga0207652_10025493 3300025921 Unclassified 4918
97 Ga0207694_10002765 3300025924 Bacteria 14171
98 Ga0207709_10000825 3300025935 Bacteria 23903
99 Ga0207711_10028139 3300025941 Bacteria 4728
100 Ga0207711_10036553 3300025941 Unclassified 4167
101 Ga0207711_10066950 3300025941 Bacteria 3108
102 Ga0207689_10007136 3300025942 Bacteria 9824
103 Ga0207689_10020442 3300025942 Bacteria 5572
104 Ga0207712_10015154 3300025961 Bacteria 4968
105 Ga0207677_10092941 3300026023 Unclassified 2197
106 Ga0207703_10014248 3300026035 Bacteria 6202
107 Ga0207708_10000254 3300026075 Bacteria 42011
108 Ga0207708_10007969 3300026075 Bacteria 7848
109 Ga0207676_10007785 3300026095 Bacteria 7620
110 Ga0207676_10068632 3300026095 Bacteria 2836
111 Ga0207674_10020794 3300026116 Bacteria 7083
112 Ga0207674_10034774 3300026116 Bacteria 5264
113 Ga0207675_100131918 3300026118 Bacteria 2369
114 Ga0268264_10037605 3300028381 Bacteria 3991
115 Ga0307413_10014581 3300031824 Bacteria 3998
116 Ga0307415_100009868 3300032126 Bacteria 5381
117 Ga0373942_0014418 3300035207 Unclassified 1913
118 Ga0395900_0198441 3300037418 Bacteria 2032
119 Ga0395898_0174634 3300037466 Unclassified 2054
120 Ga0495651_0034592 3300046462 Bacteria 3938
121 Ga0495663_0000787 3300046525 Bacteria 10836
122 Ga0495598_0000493 3300046537 Bacteria 7268
123 Ga0495621_0000471 3300046539 Bacteria 9904
124 Ga0495623_0012191 3300046679 Bacteria 5569
125 Ga0495604_0021548 3300047317 Bacteria 5144
126 Ga0495602_0122476 3300048088 Bacteria 2090
127 Ga0496102_0000766 3300048905 Bacteria 31252
128 Ga0496104_0055301 3300048907 Unclassified 3753
129 Ga0496105_0004952 3300048908 Bacteria 10071
130 Ga0496106_0112023 3300048909 Unclassified 2125
131 Ga0496111_0010588 3300048914 Bacteria 6196
132 Ga0496113_0031743 3300048916 Unclassified 3836
133 Ga0501298_000592 3300049521 Bacteria 4954
134 Ga0501038_0008004 3300049574 Bacteria 9738
135 Ga0501198_002094 3300049649 Bacteria 2657
136 Ga0501202_001253 3300049652 Bacteria 4014
137 Ga0501207_002747 3300049654 Bacteria 2298
138 Ga0501217_000474 3300049661 Bacteria 6607
139 Ga0501225_0008341 3300049705 Bacteria 2974
140 Ga0501283_000432 3300049779 Bacteria 5559
141 nmdc:mga05p37_39347_c1 3300050507 Bacteria 5805
142 nmdc:mga06r32_116306_c1 3300050510 Bacteria 2634
143 nmdc:mga0a205_57677_c1 3300050515 Unclassified 3749
144 nmdc:mga0a205_94340_c1 3300050515 Bacteria 2891
145 Ga0495601_0002000 3300053077 Bacteria 11431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026075 Ga0207708_10007969 Ga0207708_100079693 457
2 3300028381 Ga0268264_10037605 Ga0268264_100376052 457
3 3300005617 Ga0068859_100205335 Ga0068859_1002053352 458
4 3300006931 Ga0097620_100205325 Ga0097620_1002053252 458
5 3300025941 Ga0207711_10036553 Ga0207711_100365532 458
6 3300009551 Ga0105238_10010644 Ga0105238_100106443 460
7 3300025924 Ga0207694_10002765 Ga0207694_100027656 460
8 3300046679 Ga0495623_0012191 Ga0495623_0012191_2459_4045 469
9 3300026035 Ga0207703_10014248 Ga0207703_100142485 471
10 3300005535 Ga0070684_100092770 Ga0070684_1000927702 472
11 3300026023 Ga0207677_10092941 Ga0207677_100929412 472
12 3300048908 Ga0496105_0004952 Ga0496105_0004952_2919_4502 472
13 3300005290 Ga0065712_10007022 Ga0065712_100070222 473
14 3300005293 Ga0065715_10006326 Ga0065715_100063261 473
15 3300009101 Ga0105247_10015232 Ga0105247_100152322 473
16 3300025900 Ga0207710_10007033 Ga0207710_100070333 473
17 3300025961 Ga0207712_10015154 Ga0207712_100151542 473
18 3300009176 Ga0105242_10054694 Ga0105242_100546942 474
19 3300046462 Ga0495651_0034592 Ga0495651_0034592_1553_3136 474
20 3300047317 Ga0495604_0021548 Ga0495604_0021548_246_1829 474
21 3300048088 Ga0495602_0122476 Ga0495602_0122476_369_1952 474
22 3300053077 Ga0495601_0002000 Ga0495601_0002000_5217_6800 474
23 3300014325 Ga0163163_10221838 Ga0163163_102218382 475
24 3300009553 Ga0105249_10010660 Ga0105249_100106604 476
25 3300005445 Ga0070708_100205594 Ga0070708_1002055941 477
26 3300049705 Ga0501225_0008341 Ga0501225_0008341_509_2200 477
27 3300006028 Ga0070717_10079247 Ga0070717_100792472 478
28 3300048916 Ga0496113_0031743 Ga0496113_0031743_1103_2695 478
29 3300005337 Ga0070682_100000254 Ga0070682_1000002542 479
30 3300009177 Ga0105248_10036215 Ga0105248_100362151 479
31 3300009093 Ga0105240_10076523 Ga0105240_100765232 480
32 3300009551 Ga0105238_10048752 Ga0105238_100487522 480
33 3300014968 Ga0157379_10005500 Ga0157379_100055008 481
34 3300048905 Ga0496102_0000766 Ga0496102_0000766_19642_21117 481
35 3300048907 Ga0496104_0055301 Ga0496104_0055301_736_2211 481
36 3300048909 Ga0496106_0112023 Ga0496106_0112023_541_2016 481
37 3300049574 Ga0501038_0008004 Ga0501038_0008004_6254_7876 481
38 3300005336 Ga0070680_100090328 Ga0070680_1000903281 483
39 3300025908 Ga0207643_10000583 Ga0207643_1000058310 486
40 3300046525 Ga0495663_0000787 Ga0495663_0000787_3478_5259 486
41 3300046537 Ga0495598_0000493 Ga0495598_0000493_3496_5223 486
42 3300046539 Ga0495621_0000471 Ga0495621_0000471_2438_4165 486
43 3300048914 Ga0496111_0010588 Ga0496111_0010588_657_2258 487
44 3300049521 Ga0501298_000592 Ga0501298_000592_2275_3969 488
45 3300049779 Ga0501283_000432 Ga0501283_000432_531_2225 488
46 3300025921 Ga0207652_10025493 Ga0207652_100254933 489
47 3300005467 Ga0070706_100000146 Ga0070706_1000001465 492
48 3300005545 Ga0070695_100033050 Ga0070695_1000330502 492
49 3300005547 Ga0070693_100041359 Ga0070693_1000413592 492
50 3300025910 Ga0207684_10001620 Ga0207684_1000162015 492
51 3300005467 Ga0070706_100004910 Ga0070706_1000049105 493
52 3300005536 Ga0070697_100002516 Ga0070697_1000025163 493
53 3300025910 Ga0207684_10024231 Ga0207684_100242312 493
54 3300005331 Ga0070670_100138689 Ga0070670_1001386891 494
55 3300005345 Ga0070692_10041641 Ga0070692_100416411 494
56 3300009093 Ga0105240_10014704 Ga0105240_100147042 494
57 3300013307 Ga0157372_10007251 Ga0157372_100072514 494
58 3300014325 Ga0163163_10233923 Ga0163163_102339232 494
59 3300025913 Ga0207695_10047582 Ga0207695_100475822 494
60 3300025942 Ga0207689_10007136 Ga0207689_100071367 494
61 3300005546 Ga0070696_100021688 Ga0070696_1000216882 495
62 3300050510 nmdc:mga06r32_116306_c1 nmdc:mga06r32_116306_c1_312_1973 495
63 3300005458 Ga0070681_10035395 Ga0070681_100353953 496
64 3300005530 Ga0070679_100015138 Ga0070679_1000151381 496
65 3300025917 Ga0207660_10041153 Ga0207660_100411532 496
66 3300035207 Ga0373942_0014418 Ga0373942_0014418_76_1794 496
67 3300005536 Ga0070697_100008906 Ga0070697_1000089063 497
68 3300009177 Ga0105248_10048666 Ga0105248_100486662 497
69 3300013100 Ga0157373_10043846 Ga0157373_100438463 497
70 3300025941 Ga0207711_10066950 Ga0207711_100669502 497
71 3300005546 Ga0070696_100004388 Ga0070696_1000043884 499
72 3300005334 Ga0068869_100066596 Ga0068869_1000665962 502
73 3300009148 Ga0105243_10008050 Ga0105243_100080507 504
74 3300025935 Ga0207709_10000825 Ga0207709_1000082510 504
75 3300005471 Ga0070698_100009864 Ga0070698_1000098642 505
76 3300005617 Ga0068859_100007171 Ga0068859_1000071712 506
77 3300006844 Ga0075428_100021649 Ga0075428_1000216493 506
78 3300006931 Ga0097620_100007169 Ga0097620_1000071692 506
79 3300009177 Ga0105248_10032086 Ga0105248_100320862 506
80 3300025941 Ga0207711_10028139 Ga0207711_100281392 506
81 3300026116 Ga0207674_10034774 Ga0207674_100347742 506
82 3300005441 Ga0070700_100000174 Ga0070700_10000017437 507
83 3300026075 Ga0207708_10000254 Ga0207708_100002548 507
84 3300026095 Ga0207676_10007785 Ga0207676_100077853 507
85 3300005334 Ga0068869_100105106 Ga0068869_1001051062 508
86 3300025942 Ga0207689_10020442 Ga0207689_100204423 508
87 3300005841 Ga0068863_100057152 Ga0068863_1000571522 509
88 3300013306 Ga0163162_10065531 Ga0163162_100655312 509
89 3300026118 Ga0207675_100131918 Ga0207675_1001319182 510
90 3300005471 Ga0070698_100006274 Ga0070698_10000627410 511
91 3300005544 Ga0070686_100025260 Ga0070686_1000252602 512
92 3300005719 Ga0068861_100088729 Ga0068861_1000887292 512
93 3300013297 Ga0157378_10025765 Ga0157378_100257653 512
94 3300005842 Ga0068858_100041062 Ga0068858_1000410622 513
95 3300003203 JGI25406J46586_10007979 JGI25406J46586_100079792 514
96 3300005290 Ga0065712_10019385 Ga0065712_100193851 514
97 3300006847 Ga0075431_100033481 Ga0075431_1000334812 515
98 3300005406 Ga0070703_10001897 Ga0070703_100018973 516
99 3300005547 Ga0070693_100025317 Ga0070693_1000253172 516
100 3300005616 Ga0068852_100035721 Ga0068852_1000357212 516
101 3300005617 Ga0068859_100019623 Ga0068859_1000196232 516
102 3300005617 Ga0068859_100058732 Ga0068859_1000587322 516
103 3300005842 Ga0068858_100056143 Ga0068858_1000561432 516
104 3300005844 Ga0068862_100046433 Ga0068862_1000464332 516
105 3300006931 Ga0097620_100019623 Ga0097620_1000196232 516
106 3300006931 Ga0097620_100058735 Ga0097620_1000587351 516
107 3300009177 Ga0105248_10216438 Ga0105248_102164382 516
108 3300009545 Ga0105237_10003746 Ga0105237_1000374622 516
109 3300013100 Ga0157373_10000717 Ga0157373_1000071725 516
110 3300025885 Ga0207653_10008163 Ga0207653_100081633 516
111 3300025914 Ga0207671_10011699 Ga0207671_100116996 516
112 3300005985 Ga0081539_10000395 Ga0081539_100003951 517
113 3300005545 Ga0070695_100105475 Ga0070695_1001054752 518
114 3300005985 Ga0081539_10002723 Ga0081539_1000272318 518
115 3300006852 Ga0075433_10065748 Ga0075433_100657482 518
116 3300006880 Ga0075429_100012520 Ga0075429_1000125202 518
117 3300009147 Ga0114129_10046982 Ga0114129_100469824 518
118 3300009147 Ga0114129_10316938 Ga0114129_103169382 518
119 3300009174 Ga0105241_10084660 Ga0105241_100846602 518
120 3300026095 Ga0207676_10068632 Ga0207676_100686322 518
121 3300026116 Ga0207674_10020794 Ga0207674_100207946 518
122 3300050507 nmdc:mga05p37_39347_c1 nmdc:mga05p37_39347_c1_3360_5054 518
123 3300050515 nmdc:mga0a205_57677_c1 nmdc:mga0a205_57677_c1_1090_2784 518
124 2162886011 MRS1b_contig_3492608 MRS1b_0391.00000300 519
125 3300005288 Ga0065714_10064424 Ga0065714_10064424176 519
126 3300005290 Ga0065712_10000117 Ga0065712_10000117176 519
127 3300005444 Ga0070694_100015083 Ga0070694_1000150833 519
128 3300005467 Ga0070706_100046191 Ga0070706_1000461912 519
129 3300005545 Ga0070695_100016288 Ga0070695_1000162881 519
130 3300005547 Ga0070693_100078222 Ga0070693_1000782221 519
131 3300005549 Ga0070704_100091091 Ga0070704_1000910911 519
132 3300005841 Ga0068863_100086461 Ga0068863_1000864611 519
133 3300009174 Ga0105241_10037439 Ga0105241_100374392 519
134 3300009545 Ga0105237_10040845 Ga0105237_100408452 519
135 3300025911 Ga0207654_10054848 Ga0207654_100548482 519
136 3300025914 Ga0207671_10024054 Ga0207671_100240542 519
137 3300031824 Ga0307413_10014581 Ga0307413_100145812 519
138 3300032126 Ga0307415_100009868 Ga0307415_1000098683 519
139 3300037418 Ga0395900_0198441 Ga0395900_0198441_113_1819 519
140 3300037466 Ga0395898_0174634 Ga0395898_0174634_261_1868 519
141 3300049649 Ga0501198_002094 Ga0501198_002094_62_1774 519
142 3300049652 Ga0501202_001253 Ga0501202_001253_1244_2956 519
143 3300049654 Ga0501207_002747 Ga0501207_002747_39_1751 519
144 3300049661 Ga0501217_000474 Ga0501217_000474_3978_5690 519
145 3300050515 nmdc:mga0a205_94340_c1 nmdc:mga0a205_94340_c1_609_2303 519

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13231

PMT_2

Dolichyl-phosphate-mannose-protein mannosyltransferase

102

245

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p2r-assembly1.cif.gz_B structure of s. cerevisiae protein o-mannosyltransferase pmt1-pmt2 complex bound to the sugar donor 0.6791 13 257
6p25-assembly1.cif.gz_A structure of s. cerevisiae protein o-mannosyltransferase pmt1-pmt2 complex bound to the sugar donor and a peptide acceptor 0.6782 8 266
7bvg-assembly1.cif.gz_A cryo-em structure of mycobacterium smegmatis arabinosyltransferase emba-embb-acpm2 in complex with di-arabinose. 0.6283 9 387
5f15-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate 0.6218 9 511
5f15-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate 0.6047 9 511
ID Description Score Start End Superfamily
af_P21503_200_377_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3555 272 408 1.20.1250.20
af_P9WJW9_258_425_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3378 271 398 1.20.1250.20
af_P9WJX7_218_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.335 272 406 1.20.1250.20
af_A4I7C5_38_257_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3329 269 407 1.20.1250.20
af_O69695_42_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3284 272 407 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1Q7NJH6-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.9348 6 514 GO:0016020
AF-A0A2V9NRY4-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.9269 6 515 GO:0016020
AF-A0A1Q7NJH6-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.9156 6 514 GO:0016020
AF-A0A1V4AWT7-F1-model_v4 PA14 domain-containing protein 0.9083 1 515 GO:0016020
AF-A0A2V8MDU0-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.8846 80 514 GO:0016020

Feature Viewer

pLDDT pTM Quality
86.93 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map