F193937

General Info

Members Datasets Scaffolds Average Seq Length
145 94 290 183

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_101108533|Ga0070711_1011085331
Length 209
Sequence MPVPAWFSDLLKRELRGHVDLSESQIAQLHEHYELLQHWNRKINLTSIPSGPEAVIRHYCESLFFTANMPVTDKAKIADLGSGAGFPGVPMAILKPEWPVALIESHQRKSVFLREATRNLSNVRVLPKRAEDVGETFDWLVSRAVDPKDVLKNVPRLAPNLGLMLGEEDWLVIETVPSIAWMESIQLPWGDRRLCVYSVPRGTSRSELG

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
76 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.62
Stem 0
Stem Tuber 0
Unclassified 19.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_101108533 3300005439 Unclassified 682
2 Ga0068869_100779520 3300005334 Unclassified 820
3 Ga0070666_10417467 3300005335 Unclassified 966
4 Ga0070682_100441568 3300005337 Unclassified 994
5 Ga0068868_100037251 3300005338 Bacteria 3769
6 Ga0070671_100150798 3300005355 Bacteria 1963
7 Ga0070713_100050029 3300005436 Bacteria 3450
8 Ga0070681_10057329 3300005458 Bacteria 3875
9 Ga0070681_10120092 3300005458 Bacteria 2564
10 Ga0070681_10233481 3300005458 Bacteria 1754
11 Ga0070679_100070261 3300005530 Bacteria 3493
12 Ga0070679_100531640 3300005530 Unclassified 1120
13 Ga0070679_100929503 3300005530 Unclassified 813
14 Ga0070697_100039919 3300005536 Bacteria 3796
15 Ga0070686_100925933 3300005544 Bacteria 710
16 Ga0068855_100198436 3300005563 Bacteria 2260
17 Ga0068857_101109832 3300005577 Unclassified 764
18 Ga0068856_100067908 3300005614 Bacteria 3523
19 Ga0068856_100408784 3300005614 Bacteria 1377
20 Ga0068856_100875236 3300005614 Unclassified 917
21 Ga0068864_100127972 3300005618 Bacteria 2278
22 Ga0068863_100006109 3300005841 Bacteria 11812
23 Ga0068858_100003109 3300005842 Bacteria 16615
24 Ga0068860_100087777 3300005843 Bacteria 2961
25 Ga0068860_100428575 3300005843 Bacteria 1312
26 Ga0068860_101418418 3300005843 Unclassified 716
27 Ga0070717_10070132 3300006028 Bacteria 2920
28 Ga0070715_10388505 3300006163 Unclassified 772
29 Ga0097621_100022222 3300006237 Bacteria 4922
30 Ga0097621_100058995 3300006237 Bacteria 3141
31 Ga0097621_100104496 3300006237 Bacteria 2387
32 Ga0097621_100114471 3300006237 Bacteria 2282
33 Ga0068871_100049020 3300006358 Bacteria 3412
34 Ga0075428_102019450 3300006844 Unclassified 597
35 Ga0075429_100285003 3300006880 Bacteria 1447
36 Ga0105240_10000907 3300009093 Bacteria 52922
37 Ga0105240_10003254 3300009093 Bacteria 25411
38 Ga0105240_10600092 3300009093 Bacteria 1212
39 Ga0111539_12543258 3300009094 Bacteria 594
40 Ga0105245_10047164 3300009098 Bacteria 3850
41 Ga0105245_10189617 3300009098 Bacteria 1969
42 Ga0105245_10251875 3300009098 Bacteria 1716
43 Ga0105247_10086955 3300009101 Bacteria 1979
44 Ga0114129_10383148 3300009147 Bacteria 1857
45 Ga0114129_11433812 3300009147 Unclassified 851
46 Ga0105241_10030378 3300009174 Bacteria 4037
47 Ga0105241_10159543 3300009174 Bacteria 1852
48 Ga0105241_10165175 3300009174 Bacteria 1823
49 Ga0105242_10020858 3300009176 Bacteria 5140
50 Ga0105242_10627928 3300009176 Bacteria 1042
51 Ga0105242_10878689 3300009176 Bacteria 894
52 Ga0105248_10395011 3300009177 Bacteria 1557
53 Ga0105248_10754213 3300009177 Bacteria 1098
54 Ga0105237_10000319 3300009545 Bacteria 67468
55 Ga0105237_10026102 3300009545 Bacteria 5970
56 Ga0105237_10090207 3300009545 Bacteria 3055
57 Ga0105238_10184448 3300009551 Bacteria 2063
58 Ga0105238_10428467 3300009551 Bacteria 1318
59 Ga0105238_10525986 3300009551 Bacteria 1185
60 Ga0105239_10005293 3300010375 Bacteria 15158
61 Ga0105239_10020734 3300010375 Bacteria 7251
62 Ga0105239_10817067 3300010375 Bacteria 1068
63 Ga0105246_11180033 3300011119 Bacteria 703
64 Ga0157370_10035577 3300013104 Bacteria 4838
65 Ga0157374_10089456 3300013296 Bacteria 2934
66 Ga0157374_10365474 3300013296 Unclassified 1435
67 Ga0157374_10477385 3300013296 Unclassified 1250
68 Ga0157374_11605070 3300013296 Unclassified 675
69 Ga0157378_10013172 3300013297 Bacteria 7235
70 Ga0157378_11356720 3300013297 Unclassified 753
71 Ga0163162_10004125 3300013306 Bacteria 13946
72 Ga0157372_10258262 3300013307 Bacteria 2023
73 Ga0157372_10567229 3300013307 Bacteria 1323
74 Ga0157375_10068545 3300013308 Bacteria 3550
75 Ga0157375_10708016 3300013308 Unclassified 1160
76 Ga0157375_11484730 3300013308 Unclassified 800
77 Ga0163163_10006834 3300014325 Bacteria 10010
78 Ga0163163_10113558 3300014325 Bacteria 2739
79 Ga0157379_10035365 3300014968 Bacteria 4454
80 Ga0157379_10717659 3300014968 Unclassified 939
81 Ga0157376_10073977 3300014969 Bacteria 2903
82 Ga0207710_10147643 3300025900 Bacteria 1139
83 Ga0207685_10320778 3300025905 Unclassified 772
84 Ga0207654_10060937 3300025911 Bacteria 2206
85 Ga0207707_10056670 3300025912 Bacteria 3410
86 Ga0207707_10175367 3300025912 Bacteria 1873
87 Ga0207707_10421239 3300025912 Bacteria 1145
88 Ga0207695_10004733 3300025913 Bacteria 18425
89 Ga0207695_10096046 3300025913 Bacteria 2966
90 Ga0207671_10027864 3300025914 Bacteria 4222
91 Ga0207671_10294784 3300025914 Bacteria 1281
92 Ga0207652_10091796 3300025921 Bacteria 2671
93 Ga0207694_10141049 3300025924 Bacteria 1938
94 Ga0207694_10775331 3300025924 Unclassified 810
95 Ga0207687_10076366 3300025927 Bacteria 2406
96 Ga0207687_10142217 3300025927 Bacteria 1821
97 Ga0207687_11077244 3300025927 Unclassified 690
98 Ga0207700_10121134 3300025928 Bacteria 2121
99 Ga0207644_10144643 3300025931 Bacteria 1834
100 Ga0207686_10376122 3300025934 Bacteria 1076
101 Ga0207689_10755061 3300025942 Unclassified 821
102 Ga0207661_10000034 3300025944 Bacteria 154138
103 Ga0207667_10080247 3300025949 Bacteria 3381
104 Ga0207667_10159092 3300025949 Bacteria 2324
105 Ga0207703_10006275 3300026035 Bacteria 9506
106 Ga0207702_10060338 3300026078 Bacteria 3233
107 Ga0207641_10287983 3300026088 Bacteria 1547
108 Ga0207648_10481048 3300026089 Bacteria 1134
109 Ga0207676_10257233 3300026095 Bacteria 1574
110 Ga0207674_10002545 3300026116 Bacteria 22967
111 Ga0207698_10076457 3300026142 Bacteria 2680
112 Ga0268264_10903369 3300028381 Bacteria 886
113 Ga0265323_10000564 3300028653 Bacteria 20537
114 Ga0265338_10337338 3300028800 Bacteria 1087
115 Ga0265338_10407781 3300028800 Unclassified 968
116 Ga0265330_10064272 3300031235 Bacteria 1594
117 Ga0265325_10048962 3300031241 Bacteria 2183
118 Ga0265316_10027204 3300031344 Bacteria 4740
119 Ga0265316_10053445 3300031344 Bacteria 3165
120 Ga0265316_10072101 3300031344 Bacteria 2661
121 Ga0265316_10097247 3300031344 Bacteria 2241
122 Ga0265316_10218612 3300031344 Bacteria 1407
123 Ga0373923_0311522 3300035111 Unclassified 746
124 Ga0373954_0229401 3300035118 Bacteria 914
125 Ga0373931_0215846 3300035691 Bacteria 1153
126 Ga0373935_0261826 3300035692 Bacteria 1213
127 Ga0373937_0176990 3300036401 Bacteria 2003
128 Ga0436364_0051775 3300037853 Bacteria 890
129 Ga0436365_0280546 3300039437 Bacteria 688
130 Ga0453683_0392540 3300044673 Bacteria 894
131 Ga0495629_0122224 3300046459 Bacteria 1814
132 Ga0495580_0120206 3300046472 Bacteria 1824
133 Ga0495580_0421022 3300046472 Unclassified 898
134 Ga0495580_0439823 3300046472 Bacteria 876
135 Ga0495582_0025689 3300046473 Bacteria 3226
136 Ga0495639_0019728 3300046475 Bacteria 2942
137 Ga0495652_0071035 3300046529 Bacteria 2908
138 Ga0495665_0121956 3300046531 Bacteria 1365
139 Ga0495586_0596852 3300046535 Unclassified 638
140 Ga0495645_0053925 3300046543 Bacteria 2922
141 Ga0495634_0296410 3300046642 Unclassified 979
142 Ga0495658_0384963 3300046683 Bacteria 893
143 Ga0495669_0162666 3300046684 Bacteria 1060
144 Ga0495674_0561959 3300047319 Bacteria 907
145 nmdc:mga08y16_655925_c1 3300050511 Bacteria 1053
146 Ga0070711_101108533
147 Ga0068869_100779520
148 Ga0070666_10417467
149 Ga0070682_100441568
150 Ga0068868_100037251
151 Ga0070671_100150798
152 Ga0070713_100050029
153 Ga0070681_10057329
154 Ga0070681_10120092
155 Ga0070681_10233481
156 Ga0070679_100070261
157 Ga0070679_100531640
158 Ga0070679_100929503
159 Ga0070697_100039919
160 Ga0070686_100925933
161 Ga0068855_100198436
162 Ga0068857_101109832
163 Ga0068856_100067908
164 Ga0068856_100408784
165 Ga0068856_100875236
166 Ga0068864_100127972
167 Ga0068863_100006109
168 Ga0068858_100003109
169 Ga0068860_100087777
170 Ga0068860_100428575
171 Ga0068860_101418418
172 Ga0070717_10070132
173 Ga0070715_10388505
174 Ga0097621_100022222
175 Ga0097621_100058995
176 Ga0097621_100104496
177 Ga0097621_100114471
178 Ga0068871_100049020
179 Ga0075428_102019450
180 Ga0075429_100285003
181 Ga0105240_10000907
182 Ga0105240_10003254
183 Ga0105240_10600092
184 Ga0111539_12543258
185 Ga0105245_10047164
186 Ga0105245_10189617
187 Ga0105245_10251875
188 Ga0105247_10086955
189 Ga0114129_10383148
190 Ga0114129_11433812
191 Ga0105241_10030378
192 Ga0105241_10159543
193 Ga0105241_10165175
194 Ga0105242_10020858
195 Ga0105242_10627928
196 Ga0105242_10878689
197 Ga0105248_10395011
198 Ga0105248_10754213
199 Ga0105237_10000319
200 Ga0105237_10026102
201 Ga0105237_10090207
202 Ga0105238_10184448
203 Ga0105238_10428467
204 Ga0105238_10525986
205 Ga0105239_10005293
206 Ga0105239_10020734
207 Ga0105239_10817067
208 Ga0105246_11180033
209 Ga0157370_10035577
210 Ga0157374_10089456
211 Ga0157374_10365474
212 Ga0157374_10477385
213 Ga0157374_11605070
214 Ga0157378_10013172
215 Ga0157378_11356720
216 Ga0163162_10004125
217 Ga0157372_10258262
218 Ga0157372_10567229
219 Ga0157375_10068545
220 Ga0157375_10708016
221 Ga0157375_11484730
222 Ga0163163_10006834
223 Ga0163163_10113558
224 Ga0157379_10035365
225 Ga0157379_10717659
226 Ga0157376_10073977
227 Ga0207710_10147643
228 Ga0207685_10320778
229 Ga0207654_10060937
230 Ga0207707_10056670
231 Ga0207707_10175367
232 Ga0207707_10421239
233 Ga0207695_10004733
234 Ga0207695_10096046
235 Ga0207671_10027864
236 Ga0207671_10294784
237 Ga0207652_10091796
238 Ga0207694_10141049
239 Ga0207694_10775331
240 Ga0207687_10076366
241 Ga0207687_10142217
242 Ga0207687_11077244
243 Ga0207700_10121134
244 Ga0207644_10144643
245 Ga0207686_10376122
246 Ga0207689_10755061
247 Ga0207661_10000034
248 Ga0207667_10080247
249 Ga0207667_10159092
250 Ga0207703_10006275
251 Ga0207702_10060338
252 Ga0207641_10287983
253 Ga0207648_10481048
254 Ga0207676_10257233
255 Ga0207674_10002545
256 Ga0207698_10076457
257 Ga0268264_10903369
258 Ga0265323_10000564
259 Ga0265338_10337338
260 Ga0265338_10407781
261 Ga0265330_10064272
262 Ga0265325_10048962
263 Ga0265316_10027204
264 Ga0265316_10053445
265 Ga0265316_10072101
266 Ga0265316_10097247
267 Ga0265316_10218612
268 Ga0373923_0311522
269 Ga0373954_0229401
270 Ga0373931_0215846
271 Ga0373935_0261826
272 Ga0373937_0176990
273 Ga0436364_0051775
274 Ga0436365_0280546
275 Ga0453683_0392540
276 Ga0495629_0122224
277 Ga0495580_0120206
278 Ga0495580_0421022
279 Ga0495580_0439823
280 Ga0495582_0025689
281 Ga0495639_0019728
282 Ga0495652_0071035
283 Ga0495665_0121956
284 Ga0495586_0596852
285 Ga0495645_0053925
286 Ga0495634_0296410
287 Ga0495658_0384963
288 Ga0495669_0162666
289 Ga0495674_0561959
290 nmdc:mga08y16_655925_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02527

GidB

rRNA small subunit methyltransferase G

25

166

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdz-assembly1.cif.gz_A crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg 0.8286 1 165
1xdz-assembly1.cif.gz_A crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg 0.807 1 165
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.7985 33 137
5wwt-assembly1.cif.gz_A crystal structure of human nsun6/trna 0.7908 33 136
3g8b-assembly1.cif.gz_A t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 0.7831 4 165
ID Description Score Start End Superfamily
af_Q2FUQ4_1_237_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8371 4 165 3.40.50.150
af_Q9VJ34_368_539_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8359 28 134 3.40.50.150
af_Q67VB2_1_103_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.824 19 104 3.40.50.150
3g8bB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8232 2 165 3.40.50.150
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8215 47 113 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7C2EI33-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9149 4 166 GO:0005829
GO:0070043
AF-A0A537WKT3-F1-model_v4 Glucose-inhibited division protein B 0.9114 4 117 GO:0005829
GO:0070043
AF-A0A5M8SR58-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.8978 8 169 GO:0005829
GO:0070043
AF-A0A7V2MGY2-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.8925 1 167 GO:0005829
GO:0070043
AF-A0A0S7WDT5-F1-model_v4 16S rRNA (Guanine(527)-N(7))-methyltransferase RsmG 0.8881 4 117 GO:0005829
GO:0070043

Map