F193193

General Info

Members Datasets Scaffolds Average Seq Length
144 113 288 295

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221681|2644455384
Length 322
Sequence TENVVVSGRRLRLTHPDKVVYPASGTTKADVIAYYVAIAPHLLPHVAGRILTRKRWVDGVGTVEHPGDVFFEKNLPDSAPSWIRRVVVDHREHTTTYPVFEDDAALAWAGQVGALELHVPQWRLDDDGVPRNPDRLVLDLDPGPGTGLPECVDVARAARRLLKDVGLEAMPVTSGSKGIHLYAALDGTHDSDYVNAFAHEVAKTLESQMPDLVVSSMRRSERQDKVLVDWSQNNGNKTTVAPYSLRGTLEPRVAVPRTWRELGPGLRHLTLDEVLTRMKRRTDPLAGLGHETGPLEDADAPPSGTTARRGPRSESLDPAPSS

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
64 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
65 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
66 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
67 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
68 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
72 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
73 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
81 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
84 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
85 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
90 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
91 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
92 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
107 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
108 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
109 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
110 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
111 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
112 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
113 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.83
Metatranscriptomes 0
Isolates 4.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 11.81
Rhizosphere 79.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100044334 3300005329 Bacteria 4101
2 Ga0070683_100239763 3300005329 Bacteria 1725
3 Ga0070683_100394267 3300005329 Bacteria 1320
4 Ga0070680_100170126 3300005336 Bacteria 1833
5 Ga0070682_100136904 3300005337 Bacteria 1664
6 Ga0070691_10094044 3300005341 Bacteria 1481
7 Ga0070692_10015767 3300005345 Bacteria 3580
8 Ga0070675_100079659 3300005354 Bacteria 2730
9 Ga0070675_100387048 3300005354 Bacteria 1246
10 Ga0070674_100008710 3300005356 Bacteria 6052
11 Ga0070659_100235735 3300005366 Bacteria 1513
12 Ga0070714_100379313 3300005435 Bacteria 1333
13 Ga0070714_100423408 3300005435 Bacteria 1262
14 Ga0070701_10054549 3300005438 Bacteria 2085
15 Ga0070700_100002368 3300005441 Bacteria 9598
16 Ga0070678_100216354 3300005456 Bacteria 1590
17 Ga0068867_100002039 3300005459 Bacteria 14139
18 Ga0070685_10038504 3300005466 Bacteria 2712
19 Ga0070679_100435486 3300005530 Bacteria 1256
20 Ga0068866_10049009 3300005718 Bacteria 2138
21 Ga0068861_100191341 3300005719 Bacteria 1710
22 Ga0068870_10009954 3300005840 Bacteria 4345
23 Ga0068862_100676033 3300005844 Bacteria 998
24 Ga0075365_10025397 3300006038 Bacteria 3749
25 Ga0075364_10090215 3300006051 Bacteria 2033
26 Ga0075428_100136424 3300006844 Bacteria 2668
27 Ga0111539_10088830 3300009094 Bacteria 3631
28 Ga0105245_10007733 3300009098 Bacteria 9412
29 Ga0105243_10008518 3300009148 Bacteria 7868
30 Ga0105238_10085053 3300009551 Bacteria 3152
31 Ga0105239_11011784 3300010375 Bacteria 956
32 Ga0157371_10001173 3300013102 Bacteria 28127
33 Ga0157369_10010034 3300013105 Bacteria 10817
34 Ga0157369_10306959 3300013105 Bacteria 1650
35 Ga0163162_10432232 3300013306 Bacteria 1449
36 Ga0157372_10040757 3300013307 Bacteria 5131
37 Ga0157372_10053547 3300013307 Bacteria 4498
38 Ga0157372_10375418 3300013307 Bacteria 1657
39 Ga0157372_10375782 3300013307 Bacteria 1656
40 Ga0157375_10052508 3300013308 Bacteria 4007
41 Ga0157375_10093535 3300013308 Bacteria 3072
42 Ga0163163_10045927 3300014325 Bacteria 4289
43 Ga0157380_10010128 3300014326 Bacteria 6774
44 Ga0157380_10021641 3300014326 Bacteria 4826
45 Ga0163161_10119455 3300017792 Bacteria 1979
46 Ga0207643_10019207 3300025908 Bacteria 3744
47 Ga0207660_10127412 3300025917 Bacteria 1935
48 Ga0207662_10159664 3300025918 Bacteria 1439
49 Ga0207652_10085296 3300025921 Bacteria 2768
50 Ga0207659_10022328 3300025926 Bacteria 4213
51 Ga0207659_10260469 3300025926 Bacteria 1411
52 Ga0207664_10020506 3300025929 Bacteria 4900
53 Ga0207690_10483541 3300025932 Bacteria 1000
54 Ga0207686_10296336 3300025934 Bacteria 1200
55 Ga0207704_10140302 3300025938 Bacteria 1689
56 Ga0207661_10138787 3300025944 Bacteria 2090
57 Ga0207661_10156796 3300025944 Bacteria 1973
58 Ga0207679_10590627 3300025945 Bacteria 1000
59 Ga0207651_10470176 3300025960 Bacteria 1082
60 Ga0207678_10165229 3300026067 Bacteria 1890
61 Ga0207678_10219957 3300026067 Bacteria 1625
62 Ga0207678_10353193 3300026067 Bacteria 1268
63 Ga0207708_10000904 3300026075 Bacteria 22288
64 Ga0207648_10003186 3300026089 Bacteria 17286
65 Ga0207676_10220202 3300026095 Bacteria 1690
66 Ga0207675_100289283 3300026118 Bacteria 1594
67 Ga0207683_10080297 3300026121 Bacteria 2893
68 Ga0207698_10306236 3300026142 Bacteria 1481
69 Ga0307408_100055407 3300031548 Bacteria 2871
70 Ga0307408_100372179 3300031548 Bacteria 1219
71 Ga0316576_10016080 3300031727 Bacteria 5044
72 Ga0316576_10100320 3300031727 Bacteria 2163
73 Ga0307405_10065454 3300031731 Bacteria 2314
74 Ga0307410_10013230 3300031852 Bacteria 4805
75 Ga0307407_10020789 3300031903 Bacteria 3370
76 Ga0307409_100310924 3300031995 Bacteria 1470
77 Ga0307416_100029683 3300032002 Bacteria 4090
78 Ga0307411_10036993 3300032005 Bacteria 3065
79 Ga0316574_0093412 3300035398 Bacteria 1921
80 Ga0316582_0446644 3300036647 Bacteria 891
81 Ga0316584_0220780 3300036712 Bacteria 1393
82 Ga0451837_1459451 3300041494 Bacteria 1104
83 Ga0451853_0298792 3300041512 Bacteria 6338
84 Ga0439448_0075235 3300042005 Bacteria 1129
85 Ga0466965_0009693 3300044683 Bacteria 4477
86 Ga0466965_0035892 3300044683 Bacteria 2430
87 Ga0466963_0184180 3300044694 Bacteria 1458
88 Ga0466971_0071799 3300044719 Bacteria 1572
89 Ga0466970_0035522 3300044765 Bacteria 2640
90 Ga0466960_0043240 3300044901 Bacteria 2142
91 Ga0466959_0086601 3300045049 Bacteria 2253
92 Ga0466967_0248821 3300045976 Bacteria 1697
93 Ga0495658_0143292 3300046683 Bacteria 1463
94 Ga0495600_0282184 3300046809 Bacteria 1051
95 Ga0495674_0477276 3300047319 Bacteria 1000
96 Ga0495680_0108653 3300047322 Bacteria 2058
97 Ga0496100_0028790 3300048903 Bacteria 3430
98 Ga0496100_0050192 3300048903 Bacteria 2702
99 Ga0496104_0194005 3300048907 Bacteria 1943
100 Ga0496105_0438718 3300048908 Bacteria 1032
101 Ga0496106_0473946 3300048909 Bacteria 1006
102 Ga0496108_0048014 3300048911 Bacteria 3569
103 Ga0496108_0078324 3300048911 Bacteria 2797
104 Ga0496108_0115960 3300048911 Bacteria 2294
105 Ga0496108_0254123 3300048911 Bacteria 1529
106 Ga0496109_0155058 3300048912 Bacteria 2145
107 Ga0496110_0019829 3300048913 Bacteria 5667
108 Ga0496110_0081814 3300048913 Bacteria 2879
109 Ga0496110_0150811 3300048913 Bacteria 2105
110 Ga0496111_0092440 3300048914 Bacteria 2217
111 Ga0496114_0097223 3300048917 Bacteria 2508
112 Ga0496114_0253611 3300048917 Bacteria 1548
113 Ga0496114_0357188 3300048917 Bacteria 1292
114 Ga0496124_0417238 3300048927 Bacteria 926
115 Ga0496125_0004126 3300048928 Bacteria 16967
116 Ga0496126_0197925 3300048929 Bacteria 1698
117 Ga0501031_0011139 3300049568 Bacteria 5860
118 Ga0501031_0078206 3300049568 Bacteria 2155
119 Ga0501034_0001684 3300049571 Bacteria 28504
120 Ga0501034_0006740 3300049571 Bacteria 12297
121 Ga0501036_0105941 3300049572 Bacteria 2378
122 Ga0501038_0002009 3300049574 Bacteria 18781
123 Ga0501039_0108784 3300049575 Bacteria 2167
124 Ga0501039_0349299 3300049575 Bacteria 1162
125 Ga0501039_0354950 3300049575 Bacteria 1152
126 Ga0501040_0242816 3300049576 Bacteria 1284
127 Ga0501046_0006542 3300049580 Bacteria 10303
128 Ga0501048_0105770 3300049582 Bacteria 1986
129 Ga0501070_0098924 3300049586 Bacteria 2413
130 Ga0501070_0716220 3300049586 Bacteria 791
131 Ga0501083_0000859 3300049744 Bacteria 20012
132 Ga0501044_0004577 3300049823 Bacteria 15468
133 Ga0501045_0058146 3300049824 Bacteria 2831
134 nmdc:mga0yw44_72178_c1 3300050492 Bacteria 2145
135 nmdc:mga08y16_143236_c1 3300050511 Bacteria 2485
136 Ga0501084_0218937 3300054114 Bacteria 1606
137 Ga0501082_0007395 3300060353 Bacteria 9478
138 Ga0501082_0161284 3300060353 Bacteria 1948
139 2644455384 2643221681 Bacteria 3707866
140 2644503918 2643221690 Bacteria 4654705
141 2644527020 2643221694 Bacteria 4392972
142 2644670247 2643221722 Bacteria 4247614
143 2855389007 2855386786 Bacteria 4752232
144 2884995458 2884994152 Bacteria 4492978
145 Ga0070683_100044334
146 Ga0070683_100239763
147 Ga0070683_100394267
148 Ga0070680_100170126
149 Ga0070682_100136904
150 Ga0070691_10094044
151 Ga0070692_10015767
152 Ga0070675_100079659
153 Ga0070675_100387048
154 Ga0070674_100008710
155 Ga0070659_100235735
156 Ga0070714_100379313
157 Ga0070714_100423408
158 Ga0070701_10054549
159 Ga0070700_100002368
160 Ga0070678_100216354
161 Ga0068867_100002039
162 Ga0070685_10038504
163 Ga0070679_100435486
164 Ga0068866_10049009
165 Ga0068861_100191341
166 Ga0068870_10009954
167 Ga0068862_100676033
168 Ga0075365_10025397
169 Ga0075364_10090215
170 Ga0075428_100136424
171 Ga0111539_10088830
172 Ga0105245_10007733
173 Ga0105243_10008518
174 Ga0105238_10085053
175 Ga0105239_11011784
176 Ga0157371_10001173
177 Ga0157369_10010034
178 Ga0157369_10306959
179 Ga0163162_10432232
180 Ga0157372_10040757
181 Ga0157372_10053547
182 Ga0157372_10375418
183 Ga0157372_10375782
184 Ga0157375_10052508
185 Ga0157375_10093535
186 Ga0163163_10045927
187 Ga0157380_10010128
188 Ga0157380_10021641
189 Ga0163161_10119455
190 Ga0207643_10019207
191 Ga0207660_10127412
192 Ga0207662_10159664
193 Ga0207652_10085296
194 Ga0207659_10022328
195 Ga0207659_10260469
196 Ga0207664_10020506
197 Ga0207690_10483541
198 Ga0207686_10296336
199 Ga0207704_10140302
200 Ga0207661_10138787
201 Ga0207661_10156796
202 Ga0207679_10590627
203 Ga0207651_10470176
204 Ga0207678_10165229
205 Ga0207678_10219957
206 Ga0207678_10353193
207 Ga0207708_10000904
208 Ga0207648_10003186
209 Ga0207676_10220202
210 Ga0207675_100289283
211 Ga0207683_10080297
212 Ga0207698_10306236
213 Ga0307408_100055407
214 Ga0307408_100372179
215 Ga0316576_10016080
216 Ga0316576_10100320
217 Ga0307405_10065454
218 Ga0307410_10013230
219 Ga0307407_10020789
220 Ga0307409_100310924
221 Ga0307416_100029683
222 Ga0307411_10036993
223 Ga0316574_0093412
224 Ga0316582_0446644
225 Ga0316584_0220780
226 Ga0451837_1459451
227 Ga0451853_0298792
228 Ga0439448_0075235
229 Ga0466965_0009693
230 Ga0466965_0035892
231 Ga0466963_0184180
232 Ga0466971_0071799
233 Ga0466970_0035522
234 Ga0466960_0043240
235 Ga0466959_0086601
236 Ga0466967_0248821
237 Ga0495658_0143292
238 Ga0495600_0282184
239 Ga0495674_0477276
240 Ga0495680_0108653
241 Ga0496100_0028790
242 Ga0496100_0050192
243 Ga0496104_0194005
244 Ga0496105_0438718
245 Ga0496106_0473946
246 Ga0496108_0048014
247 Ga0496108_0078324
248 Ga0496108_0115960
249 Ga0496108_0254123
250 Ga0496109_0155058
251 Ga0496110_0019829
252 Ga0496110_0081814
253 Ga0496110_0150811
254 Ga0496111_0092440
255 Ga0496114_0097223
256 Ga0496114_0253611
257 Ga0496114_0357188
258 Ga0496124_0417238
259 Ga0496125_0004126
260 Ga0496126_0197925
261 Ga0501031_0011139
262 Ga0501031_0078206
263 Ga0501034_0001684
264 Ga0501034_0006740
265 Ga0501036_0105941
266 Ga0501038_0002009
267 Ga0501039_0108784
268 Ga0501039_0349299
269 Ga0501039_0354950
270 Ga0501040_0242816
271 Ga0501046_0006542
272 Ga0501048_0105770
273 Ga0501070_0098924
274 Ga0501070_0716220
275 Ga0501083_0000859
276 Ga0501044_0004577
277 Ga0501045_0058146
278 nmdc:mga0yw44_72178_c1
279 nmdc:mga08y16_143236_c1
280 Ga0501084_0218937
281 Ga0501082_0007395
282 Ga0501082_0161284
283 2644455384
284 2644503918
285 2644527020
286 2644670247
287 2855389007
288 2884995458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21686

LigD_Prim-Pol

LigD, primase-polymerase domain

27

285

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.9388 4 298
2iry-assembly1.cif.gz_A crystal structure of the polymerase domain from mycobacterium tuberculosis ligase d with dgtp and manganese. 0.9373 14 296
6sa1-assembly1.cif.gz_A post catalytic complex of prim-polc from mycobacterium smegmatis with gapped dna and 3'-dutp 0.9088 2 295
2iry-assembly1.cif.gz_A crystal structure of the polymerase domain from mycobacterium tuberculosis ligase d with dgtp and manganese. 0.893 14 296
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.8781 4 298
ID Description Score Start End Superfamily
2iruB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9661 140 281 3.30.70.3300
2iruB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9525 140 281 3.30.70.3300
af_P9WNV3_16_301_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9497 21 296 3.90.920.10
af_P95226_24_305_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.916 22 295 3.90.920.10
af_O69697_22_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9056 22 291 3.90.920.10
ID Description Score Start End GO Terms
AF-A0A0T2IFG4-F1-model_v4 ATP-dependent DNA ligase 0.9878 1 296 GO:0005524
GO:0016874
GO:0046872
AF-A0A3L8P9T5-F1-model_v4 ATP-dependent DNA ligase (EC 6.5.1.1) 0.9845 103 225 GO:0003910
GO:0005524
GO:0046872
AF-A0A1S2IC91-F1-model_v4 ATP-dependent DNA ligase 0.9824 2 295 GO:0003910
GO:0005524
GO:0006281
GO:0006310
GO:0046872
AF-A3TNC2-F1-model_v4 DNA ligase (EC 6.5.1.1) 0.9805 1 296 GO:0003910
GO:0005524
GO:0046872
AF-A0A077HJK5-F1-model_v4 DNA ligase (ATP) (EC 6.5.1.1) (NHEJ DNA polymerase) 0.9776 1 292 GO:0003677
GO:0003887
GO:0003910
GO:0004527
GO:0005524
GO:0006281
GO:0006310
GO:0046872

Map