F192649

General Info

Members Datasets Scaffolds Average Seq Length
144 113 135 141

Family's Representative Sequence

Representative Sequence 3300046473|Ga0495582_0002463|Ga0495582_0002463_1974_2465
Length 163
Sequence VGKGGNIGHTGFREDERKDIEMRVMAIVKATKDSEAGVMPGEELLAEMGKFNEEMVKAGVMLAGEGLQSSAKGARVSFGGDGERTVIDGPFAETKELIAGYWLMQVRSFDEAVEWIKRCPDPHDEPGEIEIRQVFEADDFGEEFTPELREQEERTRSQAEQNR

Samples

Sample ID Description Type Environment
1 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
2 2841760612 Bosea sp. Tri-49 Isolate Nodule
3 2844104063 Bosea sp. Tri-39 Isolate Nodule
4 2851246043 Bosea sp. Tri-54 Isolate Nodule
5 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
73 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
104 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
107 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
110 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
112 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
113 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0
Isolates 6.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 4.86
Rhizoplane 6.25
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 1.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000033 3300001977 Bacteria 12733
2 JGI24751J29686_10002634 3300002459 Bacteria 3607
3 Ga0068868_100000095 3300005338 Bacteria 54537
4 Ga0070669_101216213 3300005353 Bacteria 651
5 Ga0070671_101038770 3300005355 Bacteria 719
6 Ga0070674_100000003 3300005356 Bacteria 258221
7 Ga0070674_100000020 3300005356 Bacteria 88217
8 Ga0070674_100498457 3300005356 Bacteria 1014
9 Ga0070714_100355665 3300005435 Bacteria 1376
10 Ga0070700_100654956 3300005441 Bacteria 830
11 Ga0070708_100008042 3300005445 Bacteria 8452
12 Ga0070678_101542059 3300005456 Bacteria 623
13 Ga0070662_100000005 3300005457 Bacteria 183056
14 Ga0068867_100000286 3300005459 Bacteria 33258
15 Ga0068867_100827213 3300005459 Bacteria 828
16 Ga0070706_100011855 3300005467 Bacteria 8090
17 Ga0070706_100741725 3300005467 Bacteria 910
18 Ga0070707_100700768 3300005468 Bacteria 975
19 Ga0070698_100000318 3300005471 Bacteria 49028
20 Ga0070698_100011215 3300005471 Bacteria 9523
21 Ga0070698_100935222 3300005471 Bacteria 813
22 Ga0070693_100004055 3300005547 Bacteria 6894
23 Ga0070702_100724414 3300005615 Bacteria 761
24 Ga0068852_101823776 3300005616 Bacteria 630
25 Ga0068859_102197273 3300005617 Bacteria 609
26 Ga0068866_10000002 3300005718 Bacteria 394090
27 Ga0068866_10000019 3300005718 Bacteria 64778
28 Ga0068866_10026537 3300005718 Bacteria 2737
29 Ga0068863_100000004 3300005841 Bacteria 272478
30 Ga0068860_100002501 3300005843 Bacteria 19294
31 Ga0068860_100245390 3300005843 Bacteria 1742
32 Ga0075364_10545310 3300006051 Bacteria 793
33 Ga0070715_10000012 3300006163 Bacteria 173731
34 Ga0070716_100056084 3300006173 Bacteria 2258
35 Ga0097620_102197013 3300006931 Bacteria 609
36 Ga0099794_10023857 3300007265 Bacteria 2802
37 Ga0111539_12271378 3300009094 Bacteria 629
38 Ga0114129_12905122 3300009147 Bacteria 566
39 Ga0105243_10196217 3300009148 Bacteria 1767
40 Ga0105243_10732116 3300009148 Bacteria 968
41 Ga0105242_10439150 3300009176 Bacteria 1227
42 Ga0105249_10037078 3300009553 Bacteria 4424
43 Ga0105249_10261283 3300009553 Bacteria 1720
44 Ga0105239_13562811 3300010375 Bacteria 506
45 Ga0163162_11863604 3300013306 Bacteria 688
46 Ga0157375_10225977 3300013308 Bacteria 2031
47 Ga0157379_10151150 3300014968 Bacteria 2094
48 Ga0163161_10427561 3300017792 Bacteria 1067
49 Ga0209025_1002113 3300025294 Bacteria 22404
50 Ga0209256_1031563 3300025299 Bacteria 1447
51 Ga0207642_10000001 3300025899 Bacteria 714030
52 Ga0207642_10000003 3300025899 Bacteria 650651
53 Ga0207642_10000004 3300025899 Bacteria 407822
54 Ga0207642_10000017 3300025899 Bacteria 64774
55 Ga0207642_10004735 3300025899 Bacteria 4392
56 Ga0207685_10000001 3300025905 Bacteria 604473
57 Ga0207684_10686704 3300025910 Bacteria 871
58 Ga0207646_10199907 3300025922 Bacteria 1805
59 Ga0207681_10752240 3300025923 Bacteria 812
60 Ga0207681_10864011 3300025923 Bacteria 757
61 Ga0207664_10309011 3300025929 Bacteria 1393
62 Ga0207706_10000006 3300025933 Bacteria 216994
63 Ga0207686_10108753 3300025934 Bacteria 1866
64 Ga0207709_10113200 3300025935 Bacteria 1818
65 Ga0207669_10000016 3300025937 Bacteria 124532
66 Ga0207669_10000036 3300025937 Bacteria 78568
67 Ga0207665_10107562 3300025939 Bacteria 1956
68 Ga0207712_10733981 3300025961 Bacteria 864
69 Ga0207677_10000246 3300026023 Bacteria 41847
70 Ga0207708_10723983 3300026075 Bacteria 852
71 Ga0207641_10000698 3300026088 Bacteria 36133
72 Ga0207641_10327103 3300026088 Bacteria 1455
73 Ga0207648_10001221 3300026089 Bacteria 28819
74 Ga0207648_12118716 3300026089 Bacteria 523
75 Ga0207683_10181508 3300026121 Bacteria 1908
76 Ga0207683_10593390 3300026121 Bacteria 1025
77 Ga0207698_10115099 3300026142 Bacteria 2264
78 Ga0268264_10026173 3300028381 Bacteria 4764
79 Ga0307405_10783270 3300031731 Bacteria 797
80 Ga0307413_10301551 3300031824 Bacteria 1215
81 Ga0307410_10094170 3300031852 Bacteria 2133
82 Ga0307406_10182291 3300031901 Bacteria 1530
83 Ga0307411_10428980 3300032005 Bacteria 1100
84 Ga0307415_100493999 3300032126 Bacteria 1068
85 Ga0307415_100998556 3300032126 Bacteria 778
86 Ga0373923_0692695 3300035111 Bacteria 506
87 Ga0436363_0967797 3300039450 Bacteria 2787
88 Ga0439439_0073023 3300041406 Bacteria 921
89 Ga0451807_0609315 3300041486 Bacteria 1984
90 Ga0466960_0232760 3300044901 Bacteria 1017
91 Ga0466967_0185349 3300045976 Bacteria 1965
92 Ga0495592_0237762 3300046454 Bacteria 1210
93 Ga0495603_0000049 3300046455 Bacteria 51075
94 Ga0495651_0738483 3300046462 Bacteria 611
95 Ga0495582_0002463 3300046473 Bacteria 10319
96 Ga0495582_0492580 3300046473 Bacteria 708
97 Ga0495608_0373336 3300046511 Bacteria 875
98 Ga0495630_0214557 3300046517 Bacteria 1469
99 Ga0495630_0349117 3300046517 Bacteria 1132
100 Ga0495640_0791843 3300046533 Bacteria 565
101 Ga0495586_0251714 3300046535 Bacteria 1008
102 Ga0495645_0042721 3300046543 Bacteria 3305
103 Ga0495667_0495036 3300046559 Bacteria 766
104 Ga0495656_0000222 3300046615 Bacteria 20249
105 Ga0495634_0000172 3300046642 Bacteria 59936
106 Ga0495657_0407598 3300046675 Bacteria 799
107 Ga0495647_0155162 3300046681 Bacteria 984
108 Ga0495658_0002030 3300046683 Bacteria 10304
109 Ga0495658_0316864 3300046683 Bacteria 988
110 Ga0495613_0210920 3300046689 Bacteria 1366
111 Ga0495679_088916 3300047446 Bacteria 868
112 Ga0495684_0550001 3300047471 Bacteria 786
113 Ga0495602_0057984 3300048088 Bacteria 3393
114 Ga0496104_0000006 3300048907 Bacteria 536446
115 Ga0496104_0011315 3300048907 Bacteria 7987
116 Ga0496104_1671362 3300048907 Bacteria 539
117 Ga0496105_0000488 3300048908 Bacteria 26096
118 Ga0496110_0002902 3300048913 Bacteria 12978
119 Ga0496111_0000868 3300048914 Bacteria 16400
120 Ga0496112_0000002 3300048915 Bacteria 782039
121 Ga0496113_0313935 3300048916 Bacteria 1256
122 Ga0501071_0724629 3300049587 Bacteria 766
123 Ga0501072_0515116 3300049588 Bacteria 946
124 Ga0501221_210597 3300049704 Bacteria 544
125 Ga0501225_0044909 3300049705 Bacteria 1223
126 Ga0501080_0250397 3300049742 Bacteria 1615
127 Ga0501080_0288329 3300049742 Bacteria 1491
128 nmdc:mga0yw44_611765_c1 3300050492 Bacteria 740
129 nmdc:mga08x19_228269_c1 3300050514 Bacteria 1281
130 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
131 nmdc:mga0sz30_182479_c1 3300050516 Bacteria 931
132 Ga0495601_0014155 3300053077 Bacteria 4806
133 Ga0495601_0730793 3300053077 Bacteria 631
134 Ga0495619_0378119 3300053085 Bacteria 979
135 Ga0500592_018101 3300053116 Bacteria 1131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0967797 Ga0436363_0967797_348_707 114
2 iso_pu_bacteria 2841760612 2841765651 135
3 iso_pu_bacteria 2841760612 2841765652 135
4 iso_pu_bacteria 2844104063 2844107261 135
5 iso_pu_bacteria 2844104063 2844107262 135
6 iso_pu_bacteria 2851246043 2851249301 135
7 iso_pu_bacteria 2851246043 2851249302 135
8 iso_pu_bacteria 8057529695 8057532159 135
9 3300041406 Ga0439439_0073023 Ga0439439_0073023_261_680 136
10 3300049742 Ga0501080_0250397 Ga0501080_0250397_413_853 136
11 iso_pu_bacteria 2795385472 2795793171 137
12 iso_pu_bacteria 2899359706 2899367694 137
13 3300006051 Ga0075364_10545310 Ga0075364_105453101 138
14 3300035111 Ga0373923_0692695 Ga0373923_0692695_18_437 138
15 3300046473 Ga0495582_0492580 Ga0495582_0492580_116_544 138
16 3300046533 Ga0495640_0791843 Ga0495640_0791843_27_455 138
17 3300046535 Ga0495586_0251714 Ga0495586_0251714_122_550 138
18 3300046683 Ga0495658_0316864 Ga0495658_0316864_48_476 138
19 3300049588 Ga0501072_0515116 Ga0501072_0515116_18_434 138
20 3300049704 Ga0501221_210597 Ga0501221_210597_51_467 138
21 3300005459 Ga0068867_100000286 Ga0068867_10000028612 139
22 3300005617 Ga0068859_102197273 Ga0068859_1021972731 139
23 3300006931 Ga0097620_102197013 Ga0097620_1021970131 139
24 3300007265 Ga0099794_10023857 Ga0099794_100238573 139
25 3300009176 Ga0105242_10439150 Ga0105242_104391502 139
26 3300009553 Ga0105249_10261283 Ga0105249_102612832 139
27 3300013306 Ga0163162_11863604 Ga0163162_118636041 139
28 3300014968 Ga0157379_10151150 Ga0157379_101511502 139
29 3300025294 Ga0209025_1002113 Ga0209025_100211313 139
30 3300025299 Ga0209256_1031563 Ga0209256_10315632 139
31 3300025961 Ga0207712_10733981 Ga0207712_107339811 139
32 3300041486 Ga0451807_0609315 Ga0451807_0609315_807_1226 139
33 3300045976 Ga0466967_0185349 Ga0466967_0185349_1328_1747 139
34 3300046454 Ga0495592_0237762 Ga0495592_0237762_163_582 139
35 3300046462 Ga0495651_0738483 Ga0495651_0738483_105_524 139
36 3300046511 Ga0495608_0373336 Ga0495608_0373336_214_633 139
37 3300046517 Ga0495630_0349117 Ga0495630_0349117_157_576 139
38 3300046543 Ga0495645_0042721 Ga0495645_0042721_2724_3143 139
39 3300046559 Ga0495667_0495036 Ga0495667_0495036_267_686 139
40 3300046615 Ga0495656_0000222 Ga0495656_0000222_14717_15136 139
41 3300046642 Ga0495634_0000172 Ga0495634_0000172_16216_16635 139
42 3300046675 Ga0495657_0407598 Ga0495657_0407598_260_679 139
43 3300046681 Ga0495647_0155162 Ga0495647_0155162_26_445 139
44 3300046689 Ga0495613_0210920 Ga0495613_0210920_190_609 139
45 3300047446 Ga0495679_088916 Ga0495679_088916_277_696 139
46 3300047471 Ga0495684_0550001 Ga0495684_0550001_50_469 139
47 3300048088 Ga0495602_0057984 Ga0495602_0057984_706_1125 139
48 3300048907 Ga0496104_0000006 Ga0496104_0000006_251782_252201 139
49 3300048907 Ga0496104_0011315 Ga0496104_0011315_2541_2960 139
50 3300048907 Ga0496104_1671362 Ga0496104_1671362_70_489 139
51 3300048908 Ga0496105_0000488 Ga0496105_0000488_284_703 139
52 3300048913 Ga0496110_0002902 Ga0496110_0002902_1914_2333 139
53 3300048914 Ga0496111_0000868 Ga0496111_0000868_2338_2757 139
54 3300048915 Ga0496112_0000002 Ga0496112_0000002_309250_309669 139
55 3300048916 Ga0496113_0313935 Ga0496113_0313935_484_903 139
56 3300049587 Ga0501071_0724629 Ga0501071_0724629_129_560 139
57 3300050492 nmdc:mga0yw44_611765_c1 nmdc:mga0yw44_611765_c1_99_521 139
58 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_263680_264099 139
59 3300050516 nmdc:mga0sz30_182479_c1 nmdc:mga0sz30_182479_c1_250_672 139
60 3300053077 Ga0495601_0014155 Ga0495601_0014155_3610_4029 139
61 3300053077 Ga0495601_0730793 Ga0495601_0730793_194_613 139
62 3300053085 Ga0495619_0378119 Ga0495619_0378119_488_907 139
63 3300009147 Ga0114129_12905122 Ga0114129_129051221 140
64 3300005353 Ga0070669_101216213 Ga0070669_1012162131 141
65 3300005355 Ga0070671_101038770 Ga0070671_1010387702 141
66 3300005445 Ga0070708_100008042 Ga0070708_1000080421 141
67 3300005467 Ga0070706_100011855 Ga0070706_1000118559 141
68 3300005468 Ga0070707_100700768 Ga0070707_1007007681 141
69 3300005471 Ga0070698_100000318 Ga0070698_10000031843 141
70 3300005471 Ga0070698_100011215 Ga0070698_1000112152 141
71 3300005471 Ga0070698_100935222 Ga0070698_1009352222 141
72 3300005843 Ga0068860_100245390 Ga0068860_1002453901 141
73 3300009094 Ga0111539_12271378 Ga0111539_122713781 141
74 3300009148 Ga0105243_10732116 Ga0105243_107321162 141
75 3300009553 Ga0105249_10037078 Ga0105249_100370786 141
76 3300025922 Ga0207646_10199907 Ga0207646_101999072 141
77 3300025923 Ga0207681_10864011 Ga0207681_108640111 141
78 3300026075 Ga0207708_10723983 Ga0207708_107239832 141
79 3300026088 Ga0207641_10327103 Ga0207641_103271033 141
80 3300031731 Ga0307405_10783270 Ga0307405_107832702 141
81 3300031824 Ga0307413_10301551 Ga0307413_103015512 141
82 3300031852 Ga0307410_10094170 Ga0307410_100941702 141
83 3300031901 Ga0307406_10182291 Ga0307406_101822911 141
84 3300032005 Ga0307411_10428980 Ga0307411_104289802 141
85 3300032126 Ga0307415_100493999 Ga0307415_1004939992 141
86 3300032126 Ga0307415_100998556 Ga0307415_1009985561 141
87 3300044901 Ga0466960_0232760 Ga0466960_0232760_266_691 141
88 3300046517 Ga0495630_0214557 Ga0495630_0214557_321_767 141
89 3300049705 Ga0501225_0044909 Ga0501225_0044909_157_591 141
90 3300053116 Ga0500592_018101 Ga0500592_018101_488_919 141
91 3300001977 JGI24746J21847_1000033 JGI24746J21847_100003310 142
92 3300002459 JGI24751J29686_10002634 JGI24751J29686_100026345 142
93 3300005338 Ga0068868_100000095 Ga0068868_10000009534 142
94 3300005356 Ga0070674_100000003 Ga0070674_100000003172 142
95 3300005356 Ga0070674_100000020 Ga0070674_10000002027 142
96 3300005356 Ga0070674_100498457 Ga0070674_1004984572 142
97 3300005435 Ga0070714_100355665 Ga0070714_1003556651 142
98 3300005441 Ga0070700_100654956 Ga0070700_1006549562 142
99 3300005456 Ga0070678_101542059 Ga0070678_1015420591 142
100 3300005457 Ga0070662_100000005 Ga0070662_100000005205 142
101 3300005459 Ga0068867_100827213 Ga0068867_1008272131 142
102 3300005467 Ga0070706_100741725 Ga0070706_1007417252 142
103 3300005547 Ga0070693_100004055 Ga0070693_1000040557 142
104 3300005615 Ga0070702_100724414 Ga0070702_1007244141 142
105 3300005616 Ga0068852_101823776 Ga0068852_1018237761 142
106 3300005718 Ga0068866_10000002 Ga0068866_10000002238 142
107 3300005718 Ga0068866_10000019 Ga0068866_1000001969 142
108 3300005718 Ga0068866_10026537 Ga0068866_100265372 142
109 3300005841 Ga0068863_100000004 Ga0068863_100000004126 142
110 3300005843 Ga0068860_100002501 Ga0068860_10000250122 142
111 3300006163 Ga0070715_10000012 Ga0070715_1000001274 142
112 3300006173 Ga0070716_100056084 Ga0070716_1000560844 142
113 3300009148 Ga0105243_10196217 Ga0105243_101962172 142
114 3300010375 Ga0105239_13562811 Ga0105239_135628111 142
115 3300013308 Ga0157375_10225977 Ga0157375_102259773 142
116 3300017792 Ga0163161_10427561 Ga0163161_104275612 142
117 3300025899 Ga0207642_10000001 Ga0207642_10000001377 142
118 3300025899 Ga0207642_10000003 Ga0207642_10000003377 142
119 3300025899 Ga0207642_10000004 Ga0207642_10000004377 142
120 3300025899 Ga0207642_10000017 Ga0207642_1000001767 142
121 3300025899 Ga0207642_10004735 Ga0207642_100047354 142
122 3300025905 Ga0207685_10000001 Ga0207685_10000001494 142
123 3300025910 Ga0207684_10686704 Ga0207684_106867041 142
124 3300025923 Ga0207681_10752240 Ga0207681_107522401 142
125 3300025929 Ga0207664_10309011 Ga0207664_103090111 142
126 3300025933 Ga0207706_10000006 Ga0207706_1000000638 142
127 3300025934 Ga0207686_10108753 Ga0207686_101087532 142
128 3300025935 Ga0207709_10113200 Ga0207709_101132002 142
129 3300025937 Ga0207669_10000016 Ga0207669_10000016121 142
130 3300025937 Ga0207669_10000036 Ga0207669_1000003647 142
131 3300025939 Ga0207665_10107562 Ga0207665_101075622 142
132 3300026023 Ga0207677_10000246 Ga0207677_1000024614 142
133 3300026088 Ga0207641_10000698 Ga0207641_1000069818 142
134 3300026089 Ga0207648_10001221 Ga0207648_100012218 142
135 3300026089 Ga0207648_12118716 Ga0207648_121187161 142
136 3300026121 Ga0207683_10181508 Ga0207683_101815082 142
137 3300026121 Ga0207683_10593390 Ga0207683_105933902 142
138 3300026142 Ga0207698_10115099 Ga0207698_101150992 142
139 3300028381 Ga0268264_10026173 Ga0268264_100261734 142
140 3300046455 Ga0495603_0000049 Ga0495603_0000049_31714_32142 142
141 3300046473 Ga0495582_0002463 Ga0495582_0002463_1974_2465 142
142 3300046683 Ga0495658_0002030 Ga0495658_0002030_7840_8331 142
143 3300049742 Ga0501080_0288329 Ga0501080_0288329_651_1091 142
144 3300050514 nmdc:mga08x19_228269_c1 nmdc:mga08x19_228269_c1_422_850 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

22

138

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6951 1 115
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.671 1 115
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6633 1 115
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.64 2 114
4fpi-assembly1.cif.gz_C crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6389 1 115
ID Description Score Start End Superfamily
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6957 2 115 3.30.70.1060
af_P0ACJ5_55_139_3.30.70.920 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6856 2 110 3.30.70.920
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6558 1 115 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6542 1 115 3.30.70.1060
af_P71888_58_138_3.30.70.920 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6431 2 113 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A150P4K2-F1-model_v4 YCII-related domain-containing protein 0.7849 1 114
AF-A0A853JA97-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.7693 1 115 GO:0004497
AF-L7U3K5-F1-model_v4 YCII-related domain-containing protein 0.766 1 115
AF-A0A550KFQ8-F1-model_v4 deleted 0.7632 1 126
AF-A0A099EU42-F1-model_v4 YCII-related domain-containing protein 0.7615 1 120

Feature Viewer

pLDDT pTM Quality
72.3 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map