F188002

General Info

Members Datasets Scaffolds Average Seq Length
143 97 286 185

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_101478119|Ga0070713_1014781191
Length 181
Sequence MRLFIATTFPADVLRPLNERVEKLKPKLPKASWLRPEAQHLTFAFLGEQEESVVDKITLDGGSGFDARLRGCGFFPNRRHARVGWVGAEPQERFVDLAQRVRNGVTAAGVELEPNEFKPHLTLMRIRDRWPPMATELFEKSLHDFQSAPFAVHEVTLYLSRLNPSGAVHTPLRTFPLRLAS

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
82 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
83 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
93 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
94 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
95 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
96 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
97 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.7
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 8.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_101478119 3300005436 Unclassified 659
2 Ga0065715_10423618 3300005293 Bacteria 855
3 Ga0070658_10004364 3300005327 Bacteria 11538
4 Ga0070658_10444448 3300005327 Bacteria 1117
5 Ga0070683_100000096 3300005329 Bacteria 57429
6 Ga0070670_100000025 3300005331 Bacteria 188514
7 Ga0068869_100046617 3300005334 Bacteria 3126
8 Ga0068869_100279923 3300005334 Bacteria 1341
9 Ga0070680_100015765 3300005336 Bacteria 5934
10 Ga0070682_100000007 3300005337 Bacteria 346590
11 Ga0070682_100727717 3300005337 Bacteria 798
12 Ga0068868_100000482 3300005338 Bacteria 26485
13 Ga0070689_100057234 3300005340 Bacteria 3026
14 Ga0070692_10000884 3300005345 Bacteria 10131
15 Ga0070675_100000010 3300005354 Bacteria 243396
16 Ga0070675_100136655 3300005354 Bacteria 2092
17 Ga0070688_100257736 3300005365 Unclassified 1244
18 Ga0070710_10463305 3300005437 Bacteria 861
19 Ga0070694_100643586 3300005444 Unclassified 857
20 Ga0070708_100290570 3300005445 Bacteria 1539
21 Ga0068867_100859808 3300005459 Bacteria 813
22 Ga0070706_100039465 3300005467 Bacteria 4359
23 Ga0070706_101039067 3300005467 Bacteria 755
24 Ga0070707_100038802 3300005468 Bacteria 4550
25 Ga0070707_100205339 3300005468 Unclassified 1920
26 Ga0070698_100060409 3300005471 Bacteria 3825
27 Ga0070698_100106092 3300005471 Bacteria 2779
28 Ga0070698_100185752 3300005471 Bacteria 2016
29 Ga0070699_100051048 3300005518 Bacteria 3581
30 Ga0070699_100222268 3300005518 Unclassified 1683
31 Ga0070699_100286736 3300005518 Bacteria 1475
32 Ga0070684_100000863 3300005535 Bacteria 21426
33 Ga0070684_100039982 3300005535 Bacteria 4035
34 Ga0070672_100001024 3300005543 Bacteria 17002
35 Ga0070686_100075903 3300005544 Bacteria 2212
36 Ga0070693_100203033 3300005547 Bacteria 1289
37 Ga0070664_100641388 3300005564 Bacteria 987
38 Ga0068854_100002762 3300005578 Bacteria 10905
39 Ga0068854_100048240 3300005578 Bacteria 3038
40 Ga0070702_100250903 3300005615 Bacteria 1199
41 Ga0068859_100322062 3300005617 Bacteria 1640
42 Ga0068864_100000007 3300005618 Bacteria 392187
43 Ga0068861_100259313 3300005719 Unclassified 1487
44 Ga0068870_10230838 3300005840 Bacteria 1138
45 Ga0070717_10000336 3300006028 Bacteria 30289
46 Ga0070717_10323210 3300006028 Bacteria 1375
47 Ga0070716_100004310 3300006173 Bacteria 6780
48 Ga0070716_100090128 3300006173 Bacteria 1854
49 Ga0075428_100004103 3300006844 Bacteria 16033
50 Ga0075428_100160770 3300006844 Bacteria 2438
51 Ga0075434_101101781 3300006871 Unclassified 807
52 Ga0068865_100284783 3300006881 Bacteria 1317
53 Ga0075436_100001644 3300006914 Bacteria 15270
54 Ga0097620_100322024 3300006931 Bacteria 1640
55 Ga0075435_100000115 3300007076 Bacteria 44397
56 Ga0075435_100051365 3300007076 Bacteria 3321
57 Ga0075435_100603418 3300007076 Unclassified 952
58 Ga0105240_10860809 3300009093 Unclassified 978
59 Ga0105245_10002002 3300009098 Bacteria 18493
60 Ga0105245_10818669 3300009098 Bacteria 970
61 Ga0105243_10470756 3300009148 Bacteria 1183
62 Ga0105242_10217463 3300009176 Bacteria 1706
63 Ga0105242_10712412 3300009176 Bacteria 983
64 Ga0105238_10000002 3300009551 Bacteria 772711
65 Ga0157369_10000459 3300013105 Bacteria 54061
66 Ga0157374_10000016 3300013296 Bacteria 293656
67 Ga0157378_10000439 3300013297 Bacteria 40268
68 Ga0157378_10001347 3300013297 Bacteria 22087
69 Ga0157378_10006693 3300013297 Bacteria 10069
70 Ga0157378_11473913 3300013297 Bacteria 725
71 Ga0163162_10020882 3300013306 Bacteria 6440
72 Ga0157372_11635639 3300013307 Bacteria 741
73 Ga0157375_10000029 3300013308 Bacteria 199310
74 Ga0157375_10000938 3300013308 Bacteria 25295
75 Ga0157375_10039550 3300013308 Bacteria 4540
76 Ga0157375_10985376 3300013308 Bacteria 983
77 Ga0163163_10424055 3300014325 Bacteria 1389
78 Ga0157377_10000004 3300014745 Bacteria 430019
79 Ga0157377_10000108 3300014745 Bacteria 56604
80 Ga0157377_10339652 3300014745 Bacteria 1004
81 Ga0157376_10000018 3300014969 Bacteria 259397
82 Ga0213873_10011183 3300021358 Bacteria 1913
83 Ga0213876_10000203 3300021384 Bacteria 60770
84 Ga0213876_10004541 3300021384 Bacteria 7752
85 Ga0207643_10226910 3300025908 Bacteria 1145
86 Ga0207705_10009456 3300025909 Bacteria 7089
87 Ga0207684_10179649 3300025910 Unclassified 1824
88 Ga0207660_10018971 3300025917 Bacteria 4594
89 Ga0207646_10030843 3300025922 Bacteria 4857
90 Ga0207646_10047761 3300025922 Bacteria 3839
91 Ga0207694_10000001 3300025924 Bacteria 4078485
92 Ga0207650_10000079 3300025925 Bacteria 130505
93 Ga0207650_10019479 3300025925 Bacteria 4768
94 Ga0207650_10340434 3300025925 Bacteria 1232
95 Ga0207659_10000001 3300025926 Bacteria 660958
96 Ga0207659_10102905 3300025926 Bacteria 2157
97 Ga0207687_10000035 3300025927 Bacteria 124800
98 Ga0207687_10000830 3300025927 Bacteria 20887
99 Ga0207687_10001164 3300025927 Bacteria 17956
100 Ga0207687_10718682 3300025927 Bacteria 849
101 Ga0207700_10140464 3300025928 Bacteria 1984
102 Ga0207686_10072381 3300025934 Bacteria 2221
103 Ga0207709_10114384 3300025935 Bacteria 1810
104 Ga0207670_10090035 3300025936 Bacteria 2167
105 Ga0207704_10135146 3300025938 Bacteria 1715
106 Ga0207665_10012674 3300025939 Bacteria 5543
107 Ga0207665_10092953 3300025939 Bacteria 2094
108 Ga0207665_10513675 3300025939 Bacteria 927
109 Ga0207691_10002795 3300025940 Bacteria 17023
110 Ga0207689_10001961 3300025942 Bacteria 19432
111 Ga0207661_10000037 3300025944 Bacteria 148458
112 Ga0207661_10613201 3300025944 Bacteria 999
113 Ga0207651_10016972 3300025960 Bacteria 4286
114 Ga0207651_10488826 3300025960 Archaea 1062
115 Ga0207640_10002647 3300025981 Bacteria 9591
116 Ga0207640_10129445 3300025981 Bacteria 1822
117 Ga0207677_10000001 3300026023 Bacteria 534789
118 Ga0207677_10000638 3300026023 Bacteria 21140
119 Ga0207703_10000069 3300026035 Bacteria 124592
120 Ga0207676_10000015 3300026095 Bacteria 329100
121 Ga0207675_100004116 3300026118 Bacteria 14076
122 Ga0307511_10001456 3300030521 Bacteria 25010
123 Ga0373932_0000063 3300035112 Bacteria 26320
124 Ga0373943_0028691 3300035170 Bacteria 2624
125 Ga0373943_0040879 3300035170 Bacteria 2240
126 Ga0436365_0059155 3300039437 Bacteria 7767
127 Ga0436365_0507938 3300039437 Bacteria 8156
128 Ga0436365_0820057 3300039437 Bacteria 16698
129 Ga0436362_0289873 3300039453 Bacteria 2105
130 Ga0451839_1143281 3300041496 Bacteria 2163
131 Ga0451577_0261727 3300042876 Bacteria 1566
132 Ga0466957_0375351 3300044842 Bacteria 969
133 Ga0466958_0211516 3300045836 Bacteria 1236
134 Ga0495679_131572 3300047446 Unclassified 678
135 Ga0496112_0946929 3300048915 Bacteria 782
136 Ga0501079_0278212 3300049741 Bacteria 1309
137 nmdc:mga0n895_1617574_c1 3300050512 Unclassified 612
138 nmdc:mga0rr50_49_c1 3300050513 Bacteria 71590
139 nmdc:mga0rr50_6888_c1 3300050513 Bacteria 6968
140 nmdc:mga08x19_1341_c1 3300050514 Bacteria 15270
141 nmdc:mga0a205_621954_c1 3300050515 Bacteria 932
142 Ga0495655_0000175 3300053083 Bacteria 12151
143 Ga0495655_0094974 3300053083 Bacteria 874
144 Ga0070713_101478119
145 Ga0065715_10423618
146 Ga0070658_10004364
147 Ga0070658_10444448
148 Ga0070683_100000096
149 Ga0070670_100000025
150 Ga0068869_100046617
151 Ga0068869_100279923
152 Ga0070680_100015765
153 Ga0070682_100000007
154 Ga0070682_100727717
155 Ga0068868_100000482
156 Ga0070689_100057234
157 Ga0070692_10000884
158 Ga0070675_100000010
159 Ga0070675_100136655
160 Ga0070688_100257736
161 Ga0070710_10463305
162 Ga0070694_100643586
163 Ga0070708_100290570
164 Ga0068867_100859808
165 Ga0070706_100039465
166 Ga0070706_101039067
167 Ga0070707_100038802
168 Ga0070707_100205339
169 Ga0070698_100060409
170 Ga0070698_100106092
171 Ga0070698_100185752
172 Ga0070699_100051048
173 Ga0070699_100222268
174 Ga0070699_100286736
175 Ga0070684_100000863
176 Ga0070684_100039982
177 Ga0070672_100001024
178 Ga0070686_100075903
179 Ga0070693_100203033
180 Ga0070664_100641388
181 Ga0068854_100002762
182 Ga0068854_100048240
183 Ga0070702_100250903
184 Ga0068859_100322062
185 Ga0068864_100000007
186 Ga0068861_100259313
187 Ga0068870_10230838
188 Ga0070717_10000336
189 Ga0070717_10323210
190 Ga0070716_100004310
191 Ga0070716_100090128
192 Ga0075428_100004103
193 Ga0075428_100160770
194 Ga0075434_101101781
195 Ga0068865_100284783
196 Ga0075436_100001644
197 Ga0097620_100322024
198 Ga0075435_100000115
199 Ga0075435_100051365
200 Ga0075435_100603418
201 Ga0105240_10860809
202 Ga0105245_10002002
203 Ga0105245_10818669
204 Ga0105243_10470756
205 Ga0105242_10217463
206 Ga0105242_10712412
207 Ga0105238_10000002
208 Ga0157369_10000459
209 Ga0157374_10000016
210 Ga0157378_10000439
211 Ga0157378_10001347
212 Ga0157378_10006693
213 Ga0157378_11473913
214 Ga0163162_10020882
215 Ga0157372_11635639
216 Ga0157375_10000029
217 Ga0157375_10000938
218 Ga0157375_10039550
219 Ga0157375_10985376
220 Ga0163163_10424055
221 Ga0157377_10000004
222 Ga0157377_10000108
223 Ga0157377_10339652
224 Ga0157376_10000018
225 Ga0213873_10011183
226 Ga0213876_10000203
227 Ga0213876_10004541
228 Ga0207643_10226910
229 Ga0207705_10009456
230 Ga0207684_10179649
231 Ga0207660_10018971
232 Ga0207646_10030843
233 Ga0207646_10047761
234 Ga0207694_10000001
235 Ga0207650_10000079
236 Ga0207650_10019479
237 Ga0207650_10340434
238 Ga0207659_10000001
239 Ga0207659_10102905
240 Ga0207687_10000035
241 Ga0207687_10000830
242 Ga0207687_10001164
243 Ga0207687_10718682
244 Ga0207700_10140464
245 Ga0207686_10072381
246 Ga0207709_10114384
247 Ga0207670_10090035
248 Ga0207704_10135146
249 Ga0207665_10012674
250 Ga0207665_10092953
251 Ga0207665_10513675
252 Ga0207691_10002795
253 Ga0207689_10001961
254 Ga0207661_10000037
255 Ga0207661_10613201
256 Ga0207651_10016972
257 Ga0207651_10488826
258 Ga0207640_10002647
259 Ga0207640_10129445
260 Ga0207677_10000001
261 Ga0207677_10000638
262 Ga0207703_10000069
263 Ga0207676_10000015
264 Ga0207675_100004116
265 Ga0307511_10001456
266 Ga0373932_0000063
267 Ga0373943_0028691
268 Ga0373943_0040879
269 Ga0436365_0059155
270 Ga0436365_0507938
271 Ga0436365_0820057
272 Ga0436362_0289873
273 Ga0451839_1143281
274 Ga0451577_0261727
275 Ga0466957_0375351
276 Ga0466958_0211516
277 Ga0495679_131572
278 Ga0496112_0946929
279 Ga0501079_0278212
280 nmdc:mga0n895_1617574_c1
281 nmdc:mga0rr50_49_c1
282 nmdc:mga0rr50_6888_c1
283 nmdc:mga08x19_1341_c1
284 nmdc:mga0a205_621954_c1
285 Ga0495655_0000175
286 Ga0495655_0094974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02834

LigT_PEase

LigT like Phosphoesterase

8

85

0.87

PF02834

LigT_PEase

LigT like Phosphoesterase

86

169

0.86

PF10469

AKAP7_NLS

AKAP7 2'5' RNA ligase-like domain

17

168

0.79

PF13563

2_5_RNA_ligase2

2'-5' RNA ligase superfamily

13

163

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fyh-assembly1.cif.gz_A solution structure of the 2'-5' rna ligase-like protein from pyrococcus furiosus 0.8815 1 181
1vgj-assembly1.cif.gz_A crystal structure of 2'-5' rna ligase from pyrococcus horikoshii 0.8741 1 185
1vgj-assembly1.cif.gz_A crystal structure of 2'-5' rna ligase from pyrococcus horikoshii 0.8697 1 185
5h7f-assembly1.cif.gz_A crystal structure of mn-derivative drcpdase 0.8653 2 182
2fyh-assembly1.cif.gz_A solution structure of the 2'-5' rna ligase-like protein from pyrococcus furiosus 0.8554 1 181
ID Description Score Start End Superfamily
1vgjA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.9141 2 185 3.90.1140.10
1vgjA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.9094 2 185 3.90.1140.10
af_Q58963_1_173_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8904 1 181 3.90.1140.10
af_Q58963_1_173_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8856 1 181 3.90.1140.10
5h7fA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8653 2 182 3.90.1140.10
ID Description Score Start End GO Terms
AF-A0A7Y2JDJ3-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9498 1 182 GO:0004113
GO:0008664
AF-A0A3D6C8V7-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9488 1 185 GO:0004113
GO:0008664
AF-A0A7C6UAZ1-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9486 1 184 GO:0004113
GO:0008664
AF-A0A1W1HAI5-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.946 2 184 GO:0004113
GO:0008664
AF-A0A2N6C534-F1-model_v4 deleted 0.9441 1 182

Map