F185938

General Info

Members Datasets Scaffolds Average Seq Length
142 120 284 179

Family's Representative Sequence

Representative Sequence 3300025938|Ga0207704_10562059|Ga0207704_105620592
Length 198
Sequence MTTQTLSYAIDEHDHLIKVDDGYYRFAAENGWADAGSSLGRSLWDYVAGRELVKLQRLLIRRVRDDIGDVELPFRCDAPAVRREMDIRIVARPGGRVVLFSARLRSEEEREVPQPLLDADVPRTKEMVQMCGWCDRFEVDGEWVEVEEAAARLELSKWFATKATDIQFWSATPAPMRSPTAFSATSPTKRISCSRSPI

Samples

Sample ID Description Type Environment
1 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
60 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
61 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
62 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
72 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
78 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
79 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
86 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
87 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
104 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
117 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
118 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 9.86
Rhizosphere 88.03
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207704_10562059 3300025938 Bacteria 929
2 JGI24746J21847_1000081 3300001977 Bacteria 10382
3 Ga0070683_100167288 3300005329 Bacteria 2086
4 Ga0070680_100088117 3300005336 Bacteria 2567
5 Ga0070682_100000009 3300005337 Bacteria 291635
6 Ga0068868_100000432 3300005338 Bacteria 28134
7 Ga0070674_100000552 3300005356 Bacteria 18794
8 Ga0070673_100000704 3300005364 Bacteria 18468
9 Ga0070659_100176460 3300005366 Bacteria 1752
10 Ga0070700_100011309 3300005441 Bacteria 4940
11 Ga0070700_101041710 3300005441 Bacteria 675
12 Ga0070694_100523112 3300005444 Bacteria 947
13 Ga0070662_100000001 3300005457 Bacteria 317995
14 Ga0070681_10033939 3300005458 Bacteria 5123
15 Ga0068867_100000437 3300005459 Bacteria 27827
16 Ga0070679_100000134 3300005530 Bacteria 59591
17 Ga0070684_100001306 3300005535 Bacteria 17854
18 Ga0070684_100112761 3300005535 Bacteria 2440
19 Ga0070693_100002639 3300005547 Bacteria 8256
20 Ga0070665_100000022 3300005548 Bacteria 379286
21 Ga0068856_100008401 3300005614 Bacteria 10057
22 Ga0068866_10000007 3300005718 Bacteria 121729
23 Ga0068863_100000050 3300005841 Bacteria 130200
24 Ga0068858_100000763 3300005842 Bacteria 33724
25 Ga0068860_100001732 3300005843 Bacteria 23258
26 Ga0081540_1076017 3300005983 Bacteria 1532
27 Ga0070715_10000003 3300006163 Bacteria 345282
28 Ga0070716_100062706 3300006173 Bacteria 2156
29 Ga0068865_101231332 3300006881 Unclassified 663
30 Ga0105245_10000735 3300009098 Bacteria 29523
31 Ga0105238_10000016 3300009551 Bacteria 236218
32 Ga0105249_10497792 3300009553 Bacteria 1263
33 Ga0105239_10504091 3300010375 Bacteria 1376
34 Ga0157374_10001491 3300013296 Bacteria 19772
35 Ga0157374_10608469 3300013296 Bacteria 1103
36 Ga0157375_10483279 3300013308 Bacteria 1403
37 Ga0163163_10423475 3300014325 Bacteria 1390
38 Ga0157379_10028039 3300014968 Bacteria 5013
39 Ga0163161_10000013 3300017792 Bacteria 258747
40 Ga0163161_10394038 3300017792 Bacteria 1109
41 Ga0207642_10000008 3300025899 Bacteria 132651
42 Ga0207685_10000003 3300025905 Bacteria 344527
43 Ga0207707_10023841 3300025912 Bacteria 5352
44 Ga0207660_10091461 3300025917 Bacteria 2257
45 Ga0207652_10001785 3300025921 Bacteria 18715
46 Ga0207694_10000012 3300025924 Bacteria 411218
47 Ga0207687_10000109 3300025927 Bacteria 59406
48 Ga0207690_10136268 3300025932 Bacteria 1803
49 Ga0207706_10000003 3300025933 Bacteria 345011
50 Ga0207669_10000066 3300025937 Bacteria 52707
51 Ga0207651_10007883 3300025960 Bacteria 5703
52 Ga0207712_10559937 3300025961 Bacteria 984
53 Ga0207677_10000369 3300026023 Bacteria 31296
54 Ga0207703_10000070 3300026035 Bacteria 123480
55 Ga0207678_10141946 3300026067 Bacteria 2050
56 Ga0207708_10035138 3300026075 Bacteria 3814
57 Ga0207708_10200675 3300026075 Bacteria 1591
58 Ga0207702_10002891 3300026078 Bacteria 16062
59 Ga0207641_10000436 3300026088 Bacteria 47925
60 Ga0207648_10004990 3300026089 Bacteria 13487
61 Ga0268266_10000029 3300028379 Bacteria 424015
62 Ga0268264_10001856 3300028381 Bacteria 19212
63 Ga0265337_1002946 3300028556 Bacteria 7555
64 Ga0265326_10000132 3300028558 Bacteria 38517
65 Ga0265322_10000012 3300028654 Bacteria 152373
66 Ga0265324_10010430 3300029957 Bacteria 3582
67 Ga0307511_10055719 3300030521 Bacteria 3100
68 Ga0265332_10032730 3300031238 Bacteria 2265
69 Ga0265328_10007194 3300031239 Bacteria 4657
70 Ga0265320_10010884 3300031240 Bacteria 5385
71 Ga0265329_10024863 3300031242 Bacteria 1985
72 Ga0265331_10003824 3300031250 Bacteria 9547
73 Ga0265327_10000003 3300031251 Bacteria 852750
74 Ga0265314_10000334 3300031711 Bacteria 66204
75 Ga0373955_0048979 3300035172 Bacteria 2293
76 Ga0451807_0262915 3300041486 Bacteria 1090
77 Ga0451807_2072950 3300041486 Bacteria 1467
78 Ga0451853_0677693 3300041512 Bacteria 3155
79 Ga0495592_0002059 3300046454 Bacteria 14160
80 Ga0495592_0118372 3300046454 Bacteria 1866
81 Ga0495603_0000216 3300046455 Bacteria 29800
82 Ga0495641_0000010 3300046461 Bacteria 158798
83 Ga0495651_0397003 3300046462 Bacteria 901
84 Ga0495651_0546805 3300046462 Unclassified 736
85 Ga0495653_0055961 3300046463 Bacteria 3009
86 Ga0495582_0000006 3300046473 Bacteria 140434
87 Ga0495662_0000036 3300046476 Bacteria 44993
88 Ga0495608_0000585 3300046511 Bacteria 25014
89 Ga0495608_0081320 3300046511 Bacteria 2105
90 Ga0495618_0000053 3300046514 Bacteria 84115
91 Ga0495628_0108983 3300046516 Bacteria 2131
92 Ga0495628_0109085 3300046516 Bacteria 2130
93 Ga0495630_0002121 3300046517 Bacteria 13796
94 Ga0495630_0089199 3300046517 Bacteria 2329
95 Ga0495630_0490488 3300046517 Unclassified 942
96 Ga0495640_0017378 3300046533 Bacteria 5363
97 Ga0495586_0014954 3300046535 Bacteria 4124
98 Ga0495587_0056606 3300046536 Bacteria 2307
99 Ga0495587_0251587 3300046536 Bacteria 993
100 Ga0495621_0000250 3300046539 Bacteria 12793
101 Ga0495645_0096236 3300046543 Bacteria 2110
102 Ga0495667_0000109 3300046559 Bacteria 59985
103 Ga0495656_0008964 3300046615 Bacteria 3589
104 Ga0495668_0023737 3300046616 Bacteria 3494
105 Ga0495634_0184289 3300046642 Bacteria 1305
106 Ga0495634_0435383 3300046642 Bacteria 775
107 Ga0495635_0000256 3300046663 Bacteria 34043
108 Ga0495635_0196689 3300046663 Bacteria 1368
109 Ga0495647_0000002 3300046681 Bacteria 174959
110 Ga0495647_0017607 3300046681 Bacteria 2530
111 Ga0495658_0000027 3300046683 Bacteria 74322
112 Ga0495613_0000042 3300046689 Bacteria 130403
113 Ga0495624_0000005 3300046690 Bacteria 158127
114 Ga0495624_0036761 3300046690 Bacteria 3155
115 Ga0495649_0003685 3300046694 Bacteria 10195
116 Ga0495600_0084034 3300046809 Bacteria 2077
117 Ga0495604_0000255 3300047317 Bacteria 47375
118 Ga0495676_0000089 3300047321 Bacteria 67896
119 Ga0495680_0000094 3300047322 Bacteria 80355
120 Ga0495680_0000332 3300047322 Bacteria 52925
121 Ga0495680_0001999 3300047322 Bacteria 21403
122 Ga0495679_043410 3300047446 Unclassified 1382
123 Ga0495684_0092554 3300047471 Bacteria 2290
124 Ga0495602_0252526 3300048088 Bacteria 1313
125 Ga0496106_0000101 3300048909 Bacteria 65644
126 Ga0496107_0175426 3300048910 Bacteria 1591
127 Ga0496108_0059767 3300048911 Bacteria 3205
128 Ga0496109_0357243 3300048912 Bacteria 1380
129 Ga0496110_0036838 3300048913 Bacteria 4250
130 Ga0496112_0000002 3300048915 Bacteria 782039
131 Ga0496112_0550057 3300048915 Bacteria 1088
132 Ga0496113_0008538 3300048916 Bacteria 6681
133 Ga0496113_0173067 3300048916 Bacteria 1710
134 Ga0496114_0029167 3300048917 Bacteria 4533
135 Ga0496114_0331469 3300048917 Bacteria 1345
136 Ga0496115_0001240 3300048918 Bacteria 18297
137 Ga0501045_0749782 3300049824 Bacteria 720
138 Ga0495601_0406816 3300053077 Bacteria 882
139 Ga0495612_0000672 3300053078 Bacteria 13816
140 Ga0495595_0000066 3300053084 Bacteria 51901
141 Ga0495619_0001545 3300053085 Bacteria 15164
142 Ga0500614_001011 3300053123 Bacteria 6963
143 Ga0207704_10562059
144 JGI24746J21847_1000081
145 Ga0070683_100167288
146 Ga0070680_100088117
147 Ga0070682_100000009
148 Ga0068868_100000432
149 Ga0070674_100000552
150 Ga0070673_100000704
151 Ga0070659_100176460
152 Ga0070700_100011309
153 Ga0070700_101041710
154 Ga0070694_100523112
155 Ga0070662_100000001
156 Ga0070681_10033939
157 Ga0068867_100000437
158 Ga0070679_100000134
159 Ga0070684_100001306
160 Ga0070684_100112761
161 Ga0070693_100002639
162 Ga0070665_100000022
163 Ga0068856_100008401
164 Ga0068866_10000007
165 Ga0068863_100000050
166 Ga0068858_100000763
167 Ga0068860_100001732
168 Ga0081540_1076017
169 Ga0070715_10000003
170 Ga0070716_100062706
171 Ga0068865_101231332
172 Ga0105245_10000735
173 Ga0105238_10000016
174 Ga0105249_10497792
175 Ga0105239_10504091
176 Ga0157374_10001491
177 Ga0157374_10608469
178 Ga0157375_10483279
179 Ga0163163_10423475
180 Ga0157379_10028039
181 Ga0163161_10000013
182 Ga0163161_10394038
183 Ga0207642_10000008
184 Ga0207685_10000003
185 Ga0207707_10023841
186 Ga0207660_10091461
187 Ga0207652_10001785
188 Ga0207694_10000012
189 Ga0207687_10000109
190 Ga0207690_10136268
191 Ga0207706_10000003
192 Ga0207669_10000066
193 Ga0207651_10007883
194 Ga0207712_10559937
195 Ga0207677_10000369
196 Ga0207703_10000070
197 Ga0207678_10141946
198 Ga0207708_10035138
199 Ga0207708_10200675
200 Ga0207702_10002891
201 Ga0207641_10000436
202 Ga0207648_10004990
203 Ga0268266_10000029
204 Ga0268264_10001856
205 Ga0265337_1002946
206 Ga0265326_10000132
207 Ga0265322_10000012
208 Ga0265324_10010430
209 Ga0307511_10055719
210 Ga0265332_10032730
211 Ga0265328_10007194
212 Ga0265320_10010884
213 Ga0265329_10024863
214 Ga0265331_10003824
215 Ga0265327_10000003
216 Ga0265314_10000334
217 Ga0373955_0048979
218 Ga0451807_0262915
219 Ga0451807_2072950
220 Ga0451853_0677693
221 Ga0495592_0002059
222 Ga0495592_0118372
223 Ga0495603_0000216
224 Ga0495641_0000010
225 Ga0495651_0397003
226 Ga0495651_0546805
227 Ga0495653_0055961
228 Ga0495582_0000006
229 Ga0495662_0000036
230 Ga0495608_0000585
231 Ga0495608_0081320
232 Ga0495618_0000053
233 Ga0495628_0108983
234 Ga0495628_0109085
235 Ga0495630_0002121
236 Ga0495630_0089199
237 Ga0495630_0490488
238 Ga0495640_0017378
239 Ga0495586_0014954
240 Ga0495587_0056606
241 Ga0495587_0251587
242 Ga0495621_0000250
243 Ga0495645_0096236
244 Ga0495667_0000109
245 Ga0495656_0008964
246 Ga0495668_0023737
247 Ga0495634_0184289
248 Ga0495634_0435383
249 Ga0495635_0000256
250 Ga0495635_0196689
251 Ga0495647_0000002
252 Ga0495647_0017607
253 Ga0495658_0000027
254 Ga0495613_0000042
255 Ga0495624_0000005
256 Ga0495624_0036761
257 Ga0495649_0003685
258 Ga0495600_0084034
259 Ga0495604_0000255
260 Ga0495676_0000089
261 Ga0495680_0000094
262 Ga0495680_0000332
263 Ga0495680_0001999
264 Ga0495679_043410
265 Ga0495684_0092554
266 Ga0495602_0252526
267 Ga0496106_0000101
268 Ga0496107_0175426
269 Ga0496108_0059767
270 Ga0496109_0357243
271 Ga0496110_0036838
272 Ga0496112_0000002
273 Ga0496112_0550057
274 Ga0496113_0008538
275 Ga0496113_0173067
276 Ga0496114_0029167
277 Ga0496114_0331469
278 Ga0496115_0001240
279 Ga0501045_0749782
280 Ga0495601_0406816
281 Ga0495612_0000672
282 Ga0495595_0000066
283 Ga0495619_0001545
284 Ga0500614_001011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mzu-assembly2.cif.gz_B crystal structure of the photoactive yellow protein domain from the sensor histidine kinase ppr from rhodospirillum centenum 0.707 10 111
3fg8-assembly3.cif.gz_C crystal structure of pas domain of rha05790 0.6975 13 114
1mzu-assembly1.cif.gz_A crystal structure of the photoactive yellow protein domain from the sensor histidine kinase ppr from rhodospirillum centenum 0.6941 11 111
1mzu-assembly3.cif.gz_C crystal structure of the photoactive yellow protein domain from the sensor histidine kinase ppr from rhodospirillum centenum 0.6927 10 111
2qkp-assembly2.cif.gz_D crystal structure of c-terminal domain of smu_1151c from streptococcus mutans 0.6865 11 112
ID Description Score Start End Superfamily
af_Q8RXC4_3_213_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8509 74 115 2.130.10.10
af_A0A368UJ62_436_712_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8095 79 119 2.130.10.10
af_Q4DNV2_6_353_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7692 76 117 2.130.10.10
af_B7YZM8_1_414_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7656 87 122 2.130.10.10
af_P9WIM9_130_271_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7379 77 114 3.40.1000.10
ID Description Score Start End GO Terms
AF-A0A2E0T238-F1-model_v4 Uncharacterized protein 0.9359 78 186
AF-A0A7Y2FGS5-F1-model_v4 PAS domain-containing protein 0.9345 15 185
AF-A0A7Y2D5S8-F1-model_v4 PAS domain-containing protein 0.9311 14 182
AF-A0A832HJI9-F1-model_v4 PAS fold-4 domain-containing protein 0.9294 14 186
AF-A0A286U2N7-F1-model_v4 PAS domain-containing protein 0.9279 11 186

Map