F179747

General Info

Members Datasets Scaffolds Average Seq Length
140 101 280 423

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10202068|Ga0207652_102020681
Length 494
Sequence MFHVTRLKRQRTFTRFWPALLLAACLAGRAQTLPADIQVGVTPATSPERDQSVRTAQPSSQAPQSPVSNRQMEQPAAQPEKPQPGGDTLVIDLDDAIQRAQKYSPQFLTAEIADQLAHEDRVQAKAALLPGVNYLNQFIYTQPNGTPSGVFVSNDGPHVYNSWATVHGDLYAPAKIADYRAAIAAEAAARARAEIASRGLVATVYQFYYTVASAQRKQLSAEQGVREAQDFVGITQKQEQGGEVAHSDVIKAEIQLEQRRRDSQEAQLALEKSRVGLAVLLFPDFRQDFTVVDSLEKNRPLPAFHDVEQLAEKNNPDIRAAQATVRQQKYGVSSARASLLPSLSFDYFFGINANQVALYNREHQNNLGSAAQAQLNIPIWTWGAARSRVHQANLRLQLAKLDLTFTQRQLLANLNSFYQEASVARDEVGSLRHSLDLSSESLKLTLLRYQAGEATVLEVVDAQTTLTQARNAFDDGLVRYQLALANLQTLTGVF

Samples

Sample ID Description Type Environment
1 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
58 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
78 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
84 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
87 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
92 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
93 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
99 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
100 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
101 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5
Rhizosphere 92.86
Stem 0
Stem Tuber 0
Unclassified 25.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207652_10202068 3300025921 Bacteria 1788
2 Ga0065712_10071530 3300005290 Bacteria 5208
3 Ga0070670_100113577 3300005331 Bacteria 2335
4 Ga0068869_100030870 3300005334 Bacteria 3766
5 Ga0070680_100038280 3300005336 Bacteria 3879
6 Ga0070680_100093941 3300005336 Unclassified 2485
7 Ga0070710_10080834 3300005437 Bacteria 1897
8 Ga0070681_10021388 3300005458 Bacteria 6487
9 Ga0070681_10046750 3300005458 Bacteria 4326
10 Ga0070698_100016518 3300005471 Bacteria 7788
11 Ga0070698_100047802 3300005471 Bacteria 4374
12 Ga0070698_100078625 3300005471 Bacteria 3297
13 Ga0070699_100088960 3300005518 Unclassified 2698
14 Ga0070679_100152175 3300005530 Unclassified 2290
15 Ga0070684_100062417 3300005535 Bacteria 3264
16 Ga0070696_100012890 3300005546 Bacteria 5611
17 Ga0070693_100051675 3300005547 Unclassified 2354
18 Ga0068855_100067903 3300005563 Bacteria 4152
19 Ga0070664_100092224 3300005564 Bacteria 2622
20 Ga0070664_100237784 3300005564 Unclassified 1634
21 Ga0068859_100157503 3300005617 Bacteria 2349
22 Ga0068864_100003956 3300005618 Bacteria 12208
23 Ga0068863_100004301 3300005841 Bacteria 14024
24 Ga0068863_100081891 3300005841 Bacteria 3058
25 Ga0068863_100103095 3300005841 Bacteria 2713
26 Ga0068858_100001195 3300005842 Bacteria 26893
27 Ga0068858_100011860 3300005842 Bacteria 8215
28 Ga0068858_100032597 3300005842 Bacteria 4838
29 Ga0068860_100042401 3300005843 Unclassified 4346
30 Ga0070717_10007561 3300006028 Bacteria 8074
31 Ga0097621_100001878 3300006237 Bacteria 14387
32 Ga0068871_100014651 3300006358 Bacteria 5850
33 Ga0097620_100157502 3300006931 Bacteria 2349
34 Ga0075435_100125200 3300007076 Bacteria 2147
35 Ga0105240_10015628 3300009093 Bacteria 10307
36 Ga0105240_10032380 3300009093 Bacteria 6769
37 Ga0105240_10066321 3300009093 Bacteria 4479
38 Ga0105240_10116836 3300009093 Bacteria 3218
39 Ga0105245_10003071 3300009098 Bacteria 14946
40 Ga0105245_10083183 3300009098 Bacteria 2930
41 Ga0105247_10011349 3300009101 Bacteria 5373
42 Ga0105242_10015710 3300009176 Bacteria 5882
43 Ga0105248_10019646 3300009177 Bacteria 7478
44 Ga0105248_10033576 3300009177 Bacteria 5732
45 Ga0105248_10034038 3300009177 Bacteria 5695
46 Ga0105248_10037037 3300009177 Bacteria 5455
47 Ga0105248_10045483 3300009177 Bacteria 4922
48 Ga0105248_10055918 3300009177 Bacteria 4427
49 Ga0105238_10223751 3300009551 Bacteria 1858
50 Ga0105249_10114183 3300009553 Unclassified 2557
51 Ga0157370_10113961 3300013104 Bacteria 2526
52 Ga0157369_10032026 3300013105 Bacteria 5784
53 Ga0157369_10190291 3300013105 Unclassified 2156
54 Ga0157378_10001529 3300013297 Bacteria 20915
55 Ga0163162_10085849 3300013306 Bacteria 3224
56 Ga0163162_10393666 3300013306 Bacteria 1518
57 Ga0157372_10158868 3300013307 Bacteria 2611
58 Ga0163163_10007249 3300014325 Bacteria 9774
59 Ga0163163_10021124 3300014325 Bacteria 6141
60 Ga0157379_10002112 3300014968 Bacteria 16472
61 Ga0157379_10133528 3300014968 Bacteria 2235
62 Ga0157376_10121192 3300014969 Unclassified 2318
63 Ga0213875_10011376 3300021388 Unclassified 4426
64 Ga0207710_10039294 3300025900 Unclassified 2094
65 Ga0207707_10016276 3300025912 Bacteria 6487
66 Ga0207695_10042023 3300025913 Bacteria 4888
67 Ga0207695_10181900 3300025913 Unclassified 2023
68 Ga0207660_10028831 3300025917 Bacteria 3802
69 Ga0207687_10005094 3300025927 Bacteria 8706
70 Ga0207665_10050337 3300025939 Unclassified 2801
71 Ga0207711_10004619 3300025941 Bacteria 11710
72 Ga0207711_10026357 3300025941 Bacteria 4876
73 Ga0207711_10131423 3300025941 Unclassified 2245
74 Ga0207689_10040801 3300025942 Bacteria 3840
75 Ga0207679_10038254 3300025945 Bacteria 3417
76 Ga0207677_10008183 3300026023 Bacteria 5825
77 Ga0207702_10122836 3300026078 Unclassified 2326
78 Ga0207641_10018719 3300026088 Bacteria 5677
79 Ga0207648_10018659 3300026089 Bacteria 6277
80 Ga0207674_10109188 3300026116 Bacteria 2743
81 Ga0268266_10016361 3300028379 Bacteria 6341
82 Ga0268266_10283145 3300028379 Bacteria 1542
83 Ga0265323_10000485 3300028653 Bacteria 22418
84 Ga0265320_10031979 3300031240 Unclassified 2698
85 Ga0265340_10024817 3300031247 Unclassified 3041
86 Ga0265316_10057063 3300031344 Unclassified 3046
87 Ga0265314_10007447 3300031711 Bacteria 9492
88 Ga0373954_0045903 3300035118 Unclassified 2042
89 Ga0373935_0003168 3300035692 Bacteria 9487
90 Ga0373927_0000698 3300035695 Bacteria 25694
91 Ga0373947_0000124 3300035725 Bacteria 38940
92 Ga0373937_0112205 3300036401 Bacteria 2536
93 Ga0373925_0000406 3300037068 Bacteria 43897
94 Ga0373925_0058840 3300037068 Unclassified 2882
95 Ga0436364_0003064 3300037853 Bacteria 6152
96 Ga0436365_1168364 3300039437 Unclassified 2697
97 Ga0451577_0008925 3300042876 Bacteria 9703
98 Ga0453683_0024210 3300044673 Unclassified 3866
99 Ga0466957_0138928 3300044842 Bacteria 1564
100 Ga0451576_0026567 3300045051 Bacteria 6226
101 Ga0466967_0010179 3300045976 Bacteria 7035
102 Ga0495592_0089870 3300046454 Bacteria 2205
103 Ga0495651_0011842 3300046462 Bacteria 6707
104 Ga0495580_0009118 3300046472 Bacteria 7825
105 Ga0495580_0050305 3300046472 Bacteria 2947
106 Ga0495580_0057778 3300046472 Bacteria 2730
107 Ga0495580_0113016 3300046472 Bacteria 1886
108 Ga0495594_0090876 3300046499 Unclassified 1711
109 Ga0495630_0052731 3300046517 Bacteria 3045
110 Ga0495640_0146084 3300046533 Unclassified 1521
111 Ga0495667_0086174 3300046559 Unclassified 2038
112 Ga0495657_0105554 3300046675 Unclassified 1790
113 Ga0495623_0006736 3300046679 Bacteria 7476
114 Ga0495646_0037902 3300046680 Unclassified 2980
115 Ga0495658_0042353 3300046683 Unclassified 2542
116 Ga0495669_0026918 3300046684 Unclassified 2513
117 Ga0495600_0092978 3300046809 Bacteria 1967
118 Ga0495581_0036572 3300047315 Bacteria 2841
119 Ga0495604_0074838 3300047317 Unclassified 2551
120 Ga0495604_0156146 3300047317 Bacteria 1616
121 Ga0495674_0062407 3300047319 Unclassified 3245
122 Ga0495674_0074221 3300047319 Unclassified 2930
123 Ga0495674_0279502 3300047319 Unclassified 1368
124 Ga0495680_0156445 3300047322 Bacteria 1658
125 Ga0495684_0004660 3300047471 Bacteria 10699
126 Ga0495684_0065384 3300047471 Bacteria 2764
127 Ga0495602_0009910 3300048088 Bacteria 9884
128 Ga0495602_0036736 3300048088 Bacteria 4555
129 Ga0495602_0171117 3300048088 Bacteria 1686
130 Ga0496104_0086474 3300048907 Unclassified 2993
131 Ga0496108_0006179 3300048911 Bacteria 9690
132 Ga0496111_0001595 3300048914 Bacteria 13116
133 Ga0496111_0054981 3300048914 Bacteria 2879
134 Ga0496112_0003432 3300048915 Bacteria 13086
135 Ga0496112_0178326 3300048915 Unclassified 2089
136 Ga0496112_0345524 3300048915 Unclassified 1431
137 nmdc:mga0rr50_156383_c1 3300050513 Bacteria 1847
138 nmdc:mga08x19_1513_c1 3300050514 Bacteria 14410
139 Ga0495601_0001539 3300053077 Bacteria 12744
140 Ga0495619_0038300 3300053085 Bacteria 3128
141 Ga0207652_10202068
142 Ga0065712_10071530
143 Ga0070670_100113577
144 Ga0068869_100030870
145 Ga0070680_100038280
146 Ga0070680_100093941
147 Ga0070710_10080834
148 Ga0070681_10021388
149 Ga0070681_10046750
150 Ga0070698_100016518
151 Ga0070698_100047802
152 Ga0070698_100078625
153 Ga0070699_100088960
154 Ga0070679_100152175
155 Ga0070684_100062417
156 Ga0070696_100012890
157 Ga0070693_100051675
158 Ga0068855_100067903
159 Ga0070664_100092224
160 Ga0070664_100237784
161 Ga0068859_100157503
162 Ga0068864_100003956
163 Ga0068863_100004301
164 Ga0068863_100081891
165 Ga0068863_100103095
166 Ga0068858_100001195
167 Ga0068858_100011860
168 Ga0068858_100032597
169 Ga0068860_100042401
170 Ga0070717_10007561
171 Ga0097621_100001878
172 Ga0068871_100014651
173 Ga0097620_100157502
174 Ga0075435_100125200
175 Ga0105240_10015628
176 Ga0105240_10032380
177 Ga0105240_10066321
178 Ga0105240_10116836
179 Ga0105245_10003071
180 Ga0105245_10083183
181 Ga0105247_10011349
182 Ga0105242_10015710
183 Ga0105248_10019646
184 Ga0105248_10033576
185 Ga0105248_10034038
186 Ga0105248_10037037
187 Ga0105248_10045483
188 Ga0105248_10055918
189 Ga0105238_10223751
190 Ga0105249_10114183
191 Ga0157370_10113961
192 Ga0157369_10032026
193 Ga0157369_10190291
194 Ga0157378_10001529
195 Ga0163162_10085849
196 Ga0163162_10393666
197 Ga0157372_10158868
198 Ga0163163_10007249
199 Ga0163163_10021124
200 Ga0157379_10002112
201 Ga0157379_10133528
202 Ga0157376_10121192
203 Ga0213875_10011376
204 Ga0207710_10039294
205 Ga0207707_10016276
206 Ga0207695_10042023
207 Ga0207695_10181900
208 Ga0207660_10028831
209 Ga0207687_10005094
210 Ga0207665_10050337
211 Ga0207711_10004619
212 Ga0207711_10026357
213 Ga0207711_10131423
214 Ga0207689_10040801
215 Ga0207679_10038254
216 Ga0207677_10008183
217 Ga0207702_10122836
218 Ga0207641_10018719
219 Ga0207648_10018659
220 Ga0207674_10109188
221 Ga0268266_10016361
222 Ga0268266_10283145
223 Ga0265323_10000485
224 Ga0265320_10031979
225 Ga0265340_10024817
226 Ga0265316_10057063
227 Ga0265314_10007447
228 Ga0373954_0045903
229 Ga0373935_0003168
230 Ga0373927_0000698
231 Ga0373947_0000124
232 Ga0373937_0112205
233 Ga0373925_0000406
234 Ga0373925_0058840
235 Ga0436364_0003064
236 Ga0436365_1168364
237 Ga0451577_0008925
238 Ga0453683_0024210
239 Ga0466957_0138928
240 Ga0451576_0026567
241 Ga0466967_0010179
242 Ga0495592_0089870
243 Ga0495651_0011842
244 Ga0495580_0009118
245 Ga0495580_0050305
246 Ga0495580_0057778
247 Ga0495580_0113016
248 Ga0495594_0090876
249 Ga0495630_0052731
250 Ga0495640_0146084
251 Ga0495667_0086174
252 Ga0495657_0105554
253 Ga0495623_0006736
254 Ga0495646_0037902
255 Ga0495658_0042353
256 Ga0495669_0026918
257 Ga0495600_0092978
258 Ga0495581_0036572
259 Ga0495604_0074838
260 Ga0495604_0156146
261 Ga0495674_0062407
262 Ga0495674_0074221
263 Ga0495674_0279502
264 Ga0495680_0156445
265 Ga0495684_0004660
266 Ga0495684_0065384
267 Ga0495602_0009910
268 Ga0495602_0036736
269 Ga0495602_0171117
270 Ga0496104_0086474
271 Ga0496108_0006179
272 Ga0496111_0001595
273 Ga0496111_0054981
274 Ga0496112_0003432
275 Ga0496112_0178326
276 Ga0496112_0345524
277 nmdc:mga0rr50_156383_c1
278 nmdc:mga08x19_1513_c1
279 Ga0495601_0001539
280 Ga0495619_0038300

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02321

OEP

Outer membrane efflux protein

304

492

0.99

PF02321

OEP

Outer membrane efflux protein

93

281

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vdd-assembly1.cif.gz_B crystal structure of the open state of tolc outer membrane component of mutlidrug efflux pumps 0.7531 30 402
2vdd-assembly1.cif.gz_B crystal structure of the open state of tolc outer membrane component of mutlidrug efflux pumps 0.7023 30 402
6wxh-assembly1.cif.gz_B colicin e1 fragment in nanodisc-embedded tolc 0.6994 30 402
4mt4-assembly1.cif.gz_C crystal structure of the campylobacter jejuni cmec outer membrane channel 0.6938 32 400
7ng9-assembly1.cif.gz_A trimeric efflux pump klebsiella tolc 0.6917 30 402
ID Description Score Start End Superfamily
4k7rA02 Mainly Beta;Single Sheet;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.7541 264 306 2.20.200.10
4mt0A02 Mainly Beta;Single Sheet;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.716 264 306 2.20.200.10
4mt4A00 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.7024 32 400 1.20.1600.10
2vddA00 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.7023 30 402 1.20.1600.10
1yc9A02 Mainly Beta;Single Sheet;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.6973 265 302 2.20.200.10
ID Description Score Start End GO Terms
AF-A0A7C7YZW3-F1-model_v4 TolC family protein 0.8015 11 402 GO:0015288
GO:0015562
GO:1990281
AF-A0A7C7YZW3-F1-model_v4 TolC family protein 0.7814 11 402 GO:0015288
GO:0015562
GO:1990281
AF-A0A7C8ASM3-F1-model_v4 deleted 0.7777 17 333
AF-A0A1M3DX02-F1-model_v4 Uncharacterized protein 0.7734 19 400 GO:0009279
GO:0015288
GO:0015562
GO:1990281
AF-A0A3D3GP60-F1-model_v4 TolC family protein 0.7729 2 399 GO:0009279
GO:0015288
GO:0015562
GO:1990281

Map