F175499

General Info

Members Datasets Scaffolds Average Seq Length
139 107 139 263

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100008626|Ga0070714_1000086266
Length 293
Sequence MERDGLRQAGGEAVVKLSVVIPAHDEADTIGPTLREVRDALAGHDIDYEIVVIDDSSRDGTAEVVGRAAARDERVRCVRNPYPNGFGYAVRTGLETFKGDAVAIVMADGSDDPDDLVLYFRVLEAGYDCAFGSRFMPGATVDGYPRLKLLLNRAVNFAIRLLFQHGYNDTTNAFKAYRREVIEQVGPFLSPHFNLTVELPLKAIVRGFSYAIVPTSWRDRTAGSSKLALREMGSRYLFIVLYVFLEHHLSRGDYRRPGGARRIRRVQRRAREERVGAIAPARRAGARDKLILH

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
62 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
77 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
78 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
81 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
82 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
83 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
84 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
87 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
88 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
89 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
90 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
102 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
105 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
106 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
107 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 10.79
Rhizosphere 86.33
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100004662 3300005329 Bacteria 11326
2 Ga0070683_100029152 3300005329 Bacteria 4994
3 Ga0070677_10000019 3300005333 Bacteria 50177
4 Ga0070680_100002847 3300005336 Bacteria 12863
5 Ga0070682_100323446 3300005337 Bacteria 1140
6 Ga0070660_100113589 3300005339 Bacteria 2157
7 Ga0070661_100017985 3300005344 Bacteria 5021
8 Ga0070692_10042972 3300005345 Bacteria 2323
9 Ga0070675_100000008 3300005354 Bacteria 250004
10 Ga0070673_100090840 3300005364 Bacteria 2495
11 Ga0070659_100000003 3300005366 Bacteria 309142
12 Ga0070659_100027621 3300005366 Bacteria 4375
13 Ga0070714_100008626 3300005435 Bacteria 7975
14 Ga0070714_100045765 3300005435 Bacteria 3710
15 Ga0070710_10000001 3300005437 Bacteria 552187
16 Ga0070681_10017599 3300005458 Bacteria 7141
17 Ga0070679_100012352 3300005530 Bacteria 8157
18 Ga0070684_100015085 3300005535 Bacteria 6280
19 Ga0070684_100016772 3300005535 Bacteria 5995
20 Ga0070684_100017106 3300005535 Bacteria 5945
21 Ga0070684_100105692 3300005535 Bacteria 2519
22 Ga0068853_100017443 3300005539 Bacteria 5925
23 Ga0068853_100029409 3300005539 Bacteria 4632
24 Ga0068855_100322521 3300005563 Bacteria 1707
25 Ga0068856_100246785 3300005614 Bacteria 1801
26 Ga0068851_10001819 3300005834 Bacteria 9330
27 Ga0068858_100000218 3300005842 Bacteria 61860
28 Ga0081539_10021887 3300005985 Bacteria 4252
29 Ga0070712_100000142 3300006175 Bacteria 37397
30 Ga0075433_10003003 3300006852 Bacteria 12960
31 Ga0075434_100061787 3300006871 Unclassified 3728
32 Ga0075434_100538754 3300006871 Unclassified 1187
33 Ga0075435_100610609 3300007076 Bacteria 946
34 Ga0105240_10335332 3300009093 Bacteria 1719
35 Ga0105237_10026575 3300009545 Bacteria 5916
36 Ga0105238_10036135 3300009551 Bacteria 5021
37 Ga0105246_10099332 3300011119 Bacteria 2116
38 Ga0157370_10029784 3300013104 Bacteria 5352
39 Ga0157370_10050013 3300013104 Bacteria 3997
40 Ga0157369_10129508 3300013105 Bacteria 2674
41 Ga0157378_10001732 3300013297 Bacteria 19592
42 Ga0157372_10041876 3300013307 Bacteria 5064
43 Ga0157375_10000095 3300013308 Bacteria 88952
44 Ga0157379_10007342 3300014968 Bacteria 9538
45 Ga0157376_10004755 3300014969 Bacteria 9448
46 Ga0163161_10123461 3300017792 Bacteria 1948
47 Ga0213874_10001896 3300021377 Bacteria 4398
48 Ga0207656_10009631 3300025321 Bacteria 3590
49 Ga0207682_10000090 3300025893 Bacteria 41635
50 Ga0207692_10000007 3300025898 Bacteria 233250
51 Ga0207707_10085984 3300025912 Bacteria 2748
52 Ga0207695_10219259 3300025913 Bacteria 1810
53 Ga0207671_10304648 3300025914 Bacteria 1259
54 Ga0207693_10002124 3300025915 Bacteria 17299
55 Ga0207660_10029489 3300025917 Bacteria 3765
56 Ga0207657_10018496 3300025919 Bacteria 6647
57 Ga0207657_10130253 3300025919 Bacteria 2062
58 Ga0207652_10006603 3300025921 Bacteria 9349
59 Ga0207659_10000062 3300025926 Bacteria 67607
60 Ga0207687_10000325 3300025927 Bacteria 32487
61 Ga0207664_10004789 3300025929 Bacteria 9195
62 Ga0207664_10142574 3300025929 Bacteria 2029
63 Ga0207664_10527136 3300025929 Bacteria 1059
64 Ga0207690_10000021 3300025932 Bacteria 217710
65 Ga0207690_10064472 3300025932 Bacteria 2502
66 Ga0207661_10000679 3300025944 Bacteria 22061
67 Ga0207661_10000788 3300025944 Bacteria 20664
68 Ga0207661_10002312 3300025944 Bacteria 13128
69 Ga0207667_10447759 3300025949 Bacteria 1312
70 Ga0207651_10004923 3300025960 Bacteria 6812
71 Ga0207703_10000028 3300026035 Bacteria 208682
72 Ga0207639_10012355 3300026041 Bacteria 5947
73 Ga0207702_10189247 3300026078 Bacteria 1900
74 Ga0207674_10549766 3300026116 Bacteria 1115
75 Ga0207698_10257374 3300026142 Bacteria 1601
76 Ga0265319_1084485 3300028563 Bacteria 1006
77 Ga0265318_10090677 3300028577 Bacteria 1126
78 Ga0307410_10026170 3300031852 Bacteria 3669
79 Ga0307409_100011355 3300031995 Bacteria 5609
80 Ga0307416_100050070 3300032002 Bacteria 3327
81 Ga0307411_10691805 3300032005 Bacteria 887
82 Ga0307415_100164987 3300032126 Bacteria 1721
83 Ga0373937_0054004 3300036401 Bacteria 3686
84 Ga0436363_0932683 3300039450 Bacteria 6945
85 Ga0466963_0040882 3300044694 Bacteria 3040
86 Ga0466963_0273792 3300044694 Bacteria 1186
87 Ga0466957_0137532 3300044842 Bacteria 1571
88 Ga0466958_0057578 3300045836 Unclassified 2362
89 Ga0466958_0058975 3300045836 Bacteria 2334
90 Ga0466967_0018711 3300045976 Bacteria 5546
91 Ga0466967_0173218 3300045976 Bacteria 2032
92 Ga0466967_0176309 3300045976 Bacteria 2014
93 Ga0495603_0022166 3300046455 Bacteria 3846
94 Ga0495629_0000028 3300046459 Bacteria 127409
95 Ga0495629_0038173 3300046459 Bacteria 3384
96 Ga0495641_0000298 3300046461 Bacteria 39640
97 Ga0495582_0000082 3300046473 Bacteria 48118
98 Ga0495639_0014998 3300046475 Bacteria 3359
99 Ga0495618_0000026 3300046514 Bacteria 113266
100 Ga0495618_0252171 3300046514 Bacteria 1107
101 Ga0495644_0000299 3300046523 Bacteria 22897
102 Ga0495645_0047930 3300046543 Bacteria 3112
103 Ga0495667_0000057 3300046559 Bacteria 100656
104 Ga0495647_0000006 3300046681 Bacteria 105867
105 Ga0495658_0000070 3300046683 Bacteria 52450
106 Ga0495624_0044753 3300046690 Bacteria 2821
107 Ga0495649_0001841 3300046694 Bacteria 15560
108 Ga0495680_0000324 3300047322 Bacteria 53748
109 Ga0495680_0001942 3300047322 Bacteria 21757
110 Ga0495679_031395 3300047446 Bacteria 1713
111 Ga0495684_0299978 3300047471 Unclassified 1154
112 Ga0496100_0000004 3300048903 Bacteria 321778
113 Ga0496101_0000007 3300048904 Bacteria 321778
114 Ga0496106_0000004 3300048909 Bacteria 279896
115 Ga0496106_0000096 3300048909 Bacteria 67122
116 Ga0496106_0289675 3300048909 Bacteria 1313
117 Ga0496107_0000001 3300048910 Bacteria 321778
118 Ga0496108_0000002 3300048911 Bacteria 700890
119 Ga0496108_0000492 3300048911 Bacteria 31518
120 Ga0496109_0000001 3300048912 Bacteria 700852
121 Ga0496109_0000058 3300048912 Bacteria 118556
122 Ga0496110_0017085 3300048913 Bacteria 6065
123 Ga0496110_0089535 3300048913 Bacteria 2751
124 Ga0496110_0302753 3300048913 Bacteria 1456
125 Ga0496111_0267123 3300048914 Bacteria 1269
126 Ga0496112_0450849 3300048915 Bacteria 1224
127 Ga0496125_0059332 3300048928 Bacteria 3084
128 Ga0501042_0309262 3300049578 Bacteria 1142
129 nmdc:mga0n895_412684_c1 3300050512 Unclassified 1365
130 nmdc:mga0n895_82771_c1 3300050512 Bacteria 3199
131 nmdc:mga0rr50_577205_c1 3300050513 Bacteria 958
132 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
133 nmdc:mga0a205_3066_c1 3300050515 Bacteria 14829
134 Ga0495601_0000189 3300053077 Bacteria 32597
135 Ga0495601_0019259 3300053077 Bacteria 4162
136 Ga0495612_0001572 3300053078 Bacteria 9411
137 Ga0495612_0036847 3300053078 Bacteria 1985
138 Ga0495619_0000041 3300053085 Bacteria 112824
139 Ga0500614_004957 3300053123 Bacteria 2798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006852 Ga0075433_10003003 Ga0075433_100030034 241
2 3300005333 Ga0070677_10000019 Ga0070677_1000001925 244
3 3300014968 Ga0157379_10007342 Ga0157379_100073426 244
4 3300025893 Ga0207682_10000090 Ga0207682_1000009013 244
5 3300048903 Ga0496100_0000004 Ga0496100_0000004_93747_94481 244
6 3300048904 Ga0496101_0000007 Ga0496101_0000007_93747_94481 244
7 3300048909 Ga0496106_0000004 Ga0496106_0000004_55161_55895 244
8 3300048910 Ga0496107_0000001 Ga0496107_0000001_93747_94481 244
9 3300048911 Ga0496108_0000002 Ga0496108_0000002_515742_516476 244
10 3300048912 Ga0496109_0000001 Ga0496109_0000001_515704_516438 244
11 3300048928 Ga0496125_0059332 Ga0496125_0059332_1202_1936 244
12 3300006871 Ga0075434_100538754 Ga0075434_1005387541 245
13 3300050515 nmdc:mga0a205_3066_c1 nmdc:mga0a205_3066_c1_3975_4712 245
14 3300053078 Ga0495612_0036847 Ga0495612_0036847_1023_1760 245
15 3300005354 Ga0070675_100000008 Ga0070675_10000000850 247
16 3300005535 Ga0070684_100016772 Ga0070684_1000167725 247
17 3300006175 Ga0070712_100000142 Ga0070712_10000014217 247
18 3300013297 Ga0157378_10001732 Ga0157378_100017327 247
19 3300025915 Ga0207693_10002124 Ga0207693_1000212417 247
20 3300025926 Ga0207659_10000062 Ga0207659_1000006261 247
21 3300025944 Ga0207661_10000788 Ga0207661_1000078815 247
22 3300028577 Ga0265318_10090677 Ga0265318_100906772 247
23 3300046459 Ga0495629_0000028 Ga0495629_0000028_81184_81927 247
24 3300046461 Ga0495641_0000298 Ga0495641_0000298_32993_33787 247
25 3300053123 Ga0500614_004957 Ga0500614_004957_1406_2200 247
26 3300048913 Ga0496110_0017085 Ga0496110_0017085_2606_3400 248
27 3300048914 Ga0496111_0267123 Ga0496111_0267123_309_1103 248
28 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_13102_13848 248
29 3300048911 Ga0496108_0000492 Ga0496108_0000492_8503_9297 249
30 3300048912 Ga0496109_0000058 Ga0496109_0000058_64416_65210 249
31 3300053077 Ga0495601_0000189 Ga0495601_0000189_6783_7577 249
32 3300011119 Ga0105246_10099332 Ga0105246_100993322 251
33 3300032005 Ga0307411_10691805 Ga0307411_106918052 251
34 3300046523 Ga0495644_0000299 Ga0495644_0000299_3375_4133 251
35 3300031852 Ga0307410_10026170 Ga0307410_100261703 252
36 3300031995 Ga0307409_100011355 Ga0307409_1000113552 252
37 3300032002 Ga0307416_100050070 Ga0307416_1000500702 252
38 3300032126 Ga0307415_100164987 Ga0307415_1001649872 252
39 3300046455 Ga0495603_0022166 Ga0495603_0022166_481_1302 252
40 3300046694 Ga0495649_0001841 Ga0495649_0001841_2022_2843 252
41 3300047446 Ga0495679_031395 Ga0495679_031395_448_1269 252
42 3300048913 Ga0496110_0302753 Ga0496110_0302753_18_779 253
43 3300048915 Ga0496112_0450849 Ga0496112_0450849_164_925 253
44 3300005364 Ga0070673_100090840 Ga0070673_1000908402 255
45 3300025960 Ga0207651_10004923 Ga0207651_100049233 255
46 3300028563 Ga0265319_1084485 Ga0265319_10844852 255
47 3300005834 Ga0068851_10001819 Ga0068851_100018196 256
48 3300025321 Ga0207656_10009631 Ga0207656_100096314 256
49 3300048909 Ga0496106_0000096 Ga0496106_0000096_56725_57498 256
50 3300046475 Ga0495639_0014998 Ga0495639_0014998_81_860 257
51 3300046514 Ga0495618_0252171 Ga0495618_0252171_224_1003 257
52 3300005539 Ga0068853_100017443 Ga0068853_1000174434 258
53 3300005985 Ga0081539_10021887 Ga0081539_100218873 258
54 3300026041 Ga0207639_10012355 Ga0207639_100123554 258
55 3300046559 Ga0495667_0000057 Ga0495667_0000057_61651_62457 258
56 3300047322 Ga0495680_0000324 Ga0495680_0000324_15902_16708 258
57 3300053078 Ga0495612_0001572 Ga0495612_0001572_290_1072 258
58 3300046543 Ga0495645_0047930 Ga0495645_0047930_1850_2635 259
59 3300048913 Ga0496110_0089535 Ga0496110_0089535_787_1584 259
60 3300017792 Ga0163161_10123461 Ga0163161_101234612 260
61 3300025927 Ga0207687_10000325 Ga0207687_100003255 260
62 3300044694 Ga0466963_0040882 Ga0466963_0040882_987_1775 260
63 3300044842 Ga0466957_0137532 Ga0466957_0137532_415_1260 260
64 3300045836 Ga0466958_0058975 Ga0466958_0058975_829_1674 260
65 3300045976 Ga0466967_0173218 Ga0466967_0173218_1213_2001 260
66 3300046459 Ga0495629_0038173 Ga0495629_0038173_2205_2993 260
67 3300005842 Ga0068858_100000218 Ga0068858_10000021856 261
68 3300013104 Ga0157370_10050013 Ga0157370_100500133 261
69 3300013308 Ga0157375_10000095 Ga0157375_1000009544 261
70 3300026035 Ga0207703_10000028 Ga0207703_1000002891 261
71 3300045836 Ga0466958_0057578 Ga0466958_0057578_61_852 261
72 3300046681 Ga0495647_0000006 Ga0495647_0000006_26875_27666 261
73 3300049578 Ga0501042_0309262 Ga0501042_0309262_75_869 261
74 3300053085 Ga0495619_0000041 Ga0495619_0000041_53460_54254 261
75 3300005435 Ga0070714_100045765 Ga0070714_1000457652 262
76 3300025929 Ga0207664_10142574 Ga0207664_101425741 262
77 3300048909 Ga0496106_0289675 Ga0496106_0289675_447_1298 262
78 3300005329 Ga0070683_100029152 Ga0070683_1000291523 263
79 3300005535 Ga0070684_100015085 Ga0070684_1000150856 263
80 3300005535 Ga0070684_100017106 Ga0070684_1000171065 263
81 3300025944 Ga0207661_10000679 Ga0207661_1000067914 263
82 3300047322 Ga0495680_0001942 Ga0495680_0001942_15812_16612 263
83 3300006871 Ga0075434_100061787 Ga0075434_1000617872 264
84 3300036401 Ga0373937_0054004 Ga0373937_0054004_1649_2470 264
85 3300050512 nmdc:mga0n895_412684_c1 nmdc:mga0n895_412684_c1_189_1034 264
86 3300050512 nmdc:mga0n895_82771_c1 nmdc:mga0n895_82771_c1_955_1809 264
87 3300005437 Ga0070710_10000001 Ga0070710_10000001346 265
88 3300021377 Ga0213874_10001896 Ga0213874_100018962 265
89 3300025898 Ga0207692_10000007 Ga0207692_1000000718 265
90 3300039450 Ga0436363_0932683 Ga0436363_0932683_4022_4855 265
91 3300046473 Ga0495582_0000082 Ga0495582_0000082_6028_6876 265
92 3300046683 Ga0495658_0000070 Ga0495658_0000070_6050_6898 265
93 3300025929 Ga0207664_10527136 Ga0207664_105271362 266
94 3300045976 Ga0466967_0176309 Ga0466967_0176309_1153_1977 266
95 3300007076 Ga0075435_100610609 Ga0075435_1006106092 272
96 3300050513 nmdc:mga0rr50_577205_c1 nmdc:mga0rr50_577205_c1_37_855 272
97 3300005345 Ga0070692_10042972 Ga0070692_100429722 273
98 3300005366 Ga0070659_100000003 Ga0070659_100000003137 273
99 3300014969 Ga0157376_10004755 Ga0157376_100047556 273
100 3300025919 Ga0207657_10018496 Ga0207657_100184964 273
101 3300025932 Ga0207690_10000021 Ga0207690_10000021196 273
102 3300044694 Ga0466963_0273792 Ga0466963_0273792_275_1105 273
103 3300045976 Ga0466967_0018711 Ga0466967_0018711_3660_4490 273
104 3300046514 Ga0495618_0000026 Ga0495618_0000026_6206_7054 273
105 3300046690 Ga0495624_0044753 Ga0495624_0044753_1227_2075 273
106 3300047471 Ga0495684_0299978 Ga0495684_0299978_46_894 273
107 3300053077 Ga0495601_0019259 Ga0495601_0019259_3083_3931 273
108 3300005329 Ga0070683_100004662 Ga0070683_1000046627 276
109 3300005336 Ga0070680_100002847 Ga0070680_1000028479 276
110 3300005337 Ga0070682_100323446 Ga0070682_1003234462 276
111 3300005339 Ga0070660_100113589 Ga0070660_1001135892 276
112 3300005344 Ga0070661_100017985 Ga0070661_1000179851 276
113 3300005366 Ga0070659_100027621 Ga0070659_1000276214 276
114 3300005435 Ga0070714_100008626 Ga0070714_1000086266 276
115 3300005458 Ga0070681_10017599 Ga0070681_100175995 276
116 3300005530 Ga0070679_100012352 Ga0070679_1000123524 276
117 3300005535 Ga0070684_100105692 Ga0070684_1001056922 276
118 3300005539 Ga0068853_100029409 Ga0068853_1000294094 276
119 3300005563 Ga0068855_100322521 Ga0068855_1003225212 276
120 3300005614 Ga0068856_100246785 Ga0068856_1002467852 276
121 3300009093 Ga0105240_10335332 Ga0105240_103353322 276
122 3300009545 Ga0105237_10026575 Ga0105237_100265754 276
123 3300009551 Ga0105238_10036135 Ga0105238_100361354 276
124 3300013104 Ga0157370_10029784 Ga0157370_100297843 276
125 3300013105 Ga0157369_10129508 Ga0157369_101295082 276
126 3300013307 Ga0157372_10041876 Ga0157372_100418764 276
127 3300025912 Ga0207707_10085984 Ga0207707_100859842 276
128 3300025913 Ga0207695_10219259 Ga0207695_102192592 276
129 3300025914 Ga0207671_10304648 Ga0207671_103046481 276
130 3300025917 Ga0207660_10029489 Ga0207660_100294893 276
131 3300025919 Ga0207657_10130253 Ga0207657_101302532 276
132 3300025921 Ga0207652_10006603 Ga0207652_100066032 276
133 3300025929 Ga0207664_10004789 Ga0207664_100047892 276
134 3300025932 Ga0207690_10064472 Ga0207690_100644723 276
135 3300025944 Ga0207661_10002312 Ga0207661_100023129 276
136 3300025949 Ga0207667_10447759 Ga0207667_104477592 276
137 3300026078 Ga0207702_10189247 Ga0207702_101892472 276
138 3300026116 Ga0207674_10549766 Ga0207674_105497661 276
139 3300026142 Ga0207698_10257374 Ga0207698_102573742 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

18

186

0.98

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

15

234

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8273 2 237
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8084 3 237
5jqx-assembly1.cif.gz_A crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with phosphoglyceric acid (pga) - gpgs*pga 0.7103 2 230
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7099 2 205
1g7u-assembly1.cif.gz_A crystal structures of kdo8p synthase in its binary complex with substrate phosphoenol pyruvate 0.7078 3 57
ID Description Score Start End Superfamily
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8504 3 226 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8367 3 226 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8295 2 243 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8081 1 185 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.797 3 225 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7C5FNM4-F1-model_v4 Glycosyltransferase 0.9657 2 107 GO:0005886
GO:0016757
AF-A0A4V1ZS11-F1-model_v4 Glycosyltransferase family 2 protein 0.9637 3 102 GO:0005886
GO:0099621
AF-A0A840AX79-F1-model_v4 Glycosyltransferase involved in cell wall biosynthesis 0.9554 3 114 GO:0004582
GO:0009247
GO:0016020
AF-A0A7V6H0B7-F1-model_v4 Glycosyltransferase 0.9552 3 81 GO:0005886
GO:0099621
AF-A0A1I7IIE2-F1-model_v4 Glycosyl transferase family 2 0.9538 2 69 GO:0016740

Feature Viewer

pLDDT pTM Quality
75.71 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map