F174147

General Info

Members Datasets Scaffolds Average Seq Length
138 100 276 180

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0640389|Ga0495630_0640389_84_689
Length 201
Sequence VSTLVDKILAIHRALDDTRIPHAFGGALALAWCTQRARGTIDIDVNVFVDRSRTVELLAALPDSVQWSDADRTRIERDGQARLWWGETPVDVFVNTTEFHEHLAEHCRWEPFGGVDVPFLGCTDLAVFKAFFDRTKDWADLEEMAAAGTLDVDRVAGILSHYLGSPEGRIDRLRLLSAPLAQLAPSRRPRPGEAGSSPGTP

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
10 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
42 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
43 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
44 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
45 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
46 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
49 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
50 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
51 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
52 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
53 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
54 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
55 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
56 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
57 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
58 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
59 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
62 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
63 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
66 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
69 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
70 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
71 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
72 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
73 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
74 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
75 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
76 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
77 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
78 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
81 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
87 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
91 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
92 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
93 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
94 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
95 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
96 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
97 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
98 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
99 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
100 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.29
Nodule 0
Rhizoplane 4.35
Rhizosphere 71.01
Stem 0
Stem Tuber 0
Unclassified 15.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0640389 3300046517 Bacteria 814
2 Ga0065704_10205838 3300005289 Unclassified 1128
3 Ga0070668_100804520 3300005347 Bacteria 835
4 Ga0070688_100910129 3300005365 Unclassified 694
5 Ga0070681_11195974 3300005458 Bacteria 682
6 Ga0068855_100092253 3300005563 Bacteria 3493
7 Ga0068857_100652657 3300005577 Unclassified 997
8 Ga0068856_100013764 3300005614 Bacteria 7821
9 Ga0068864_100046801 3300005618 Bacteria 3713
10 Ga0068861_101362406 3300005719 Bacteria 692
11 Ga0068863_101043834 3300005841 Bacteria 821
12 Ga0068863_101544652 3300005841 Unclassified 673
13 Ga0068860_100031304 3300005843 Bacteria 5114
14 Ga0068860_100064259 3300005843 Bacteria 3486
15 Ga0075365_10047901 3300006038 Bacteria 2811
16 Ga0075365_10113637 3300006038 Bacteria 1863
17 Ga0075365_10146155 3300006038 Bacteria 1643
18 Ga0075363_100019097 3300006048 Bacteria 3423
19 Ga0075363_100022880 3300006048 Bacteria 3163
20 Ga0075363_100392247 3300006048 Unclassified 815
21 Ga0075364_10018671 3300006051 Bacteria 4345
22 Ga0075364_10151453 3300006051 Bacteria 1563
23 Ga0075364_10177407 3300006051 Unclassified 1441
24 Ga0075364_10208301 3300006051 Bacteria 1326
25 Ga0075364_10285406 3300006051 Bacteria 1123
26 Ga0070712_100155581 3300006175 Bacteria 1760
27 Ga0075367_10031108 3300006178 Bacteria 3064
28 Ga0075367_10241521 3300006178 Unclassified 1132
29 Ga0075367_10299378 3300006178 Bacteria 1012
30 Ga0075367_10524232 3300006178 Bacteria 752
31 Ga0075431_100069280 3300006847 Bacteria 3639
32 Ga0068865_100298461 3300006881 Bacteria 1289
33 Ga0105240_10035458 3300009093 Bacteria 6428
34 Ga0111539_12101612 3300009094 Unclassified 655
35 Ga0105243_11080994 3300009148 Bacteria 809
36 Ga0105248_10199449 3300009177 Bacteria 2254
37 Ga0105249_10028070 3300009553 Bacteria 5080
38 Ga0157374_11029108 3300013296 Bacteria 843
39 Ga0157372_10586220 3300013307 Bacteria 1300
40 Ga0157375_11546338 3300013308 Bacteria 784
41 Ga0163163_10109320 3300014325 Bacteria 2792
42 Ga0163163_10346907 3300014325 Bacteria 1540
43 Ga0157379_10345087 3300014968 Bacteria 1362
44 Ga0207695_10168490 3300025913 Bacteria 2117
45 Ga0207706_11200274 3300025933 Bacteria 630
46 Ga0207704_10530003 3300025938 Bacteria 954
47 Ga0207711_10100329 3300025941 Bacteria 2560
48 Ga0207689_10751825 3300025942 Bacteria 823
49 Ga0207667_10034511 3300025949 Bacteria 5431
50 Ga0207667_10152263 3300025949 Bacteria 2380
51 Ga0207712_10097755 3300025961 Bacteria 2176
52 Ga0207712_10488056 3300025961 Unclassified 1051
53 Ga0207668_10759386 3300025972 Bacteria 856
54 Ga0207702_10017446 3300026078 Bacteria 5940
55 Ga0207648_10931804 3300026089 Unclassified 812
56 Ga0268264_10076056 3300028381 Bacteria 2856
57 Ga0268264_10555766 3300028381 Unclassified 1126
58 Ga0265331_10270040 3300031250 Bacteria 762
59 Ga0265327_10000008 3300031251 Bacteria 658870
60 Ga0265327_10000489 3300031251 Bacteria 69801
61 Ga0265327_10028270 3300031251 Bacteria 3211
62 Ga0316579_10200115 3300031691 Bacteria 966
63 Ga0316576_10057043 3300031727 Bacteria 2853
64 Ga0316578_10146083 3300031728 Bacteria 1424
65 Ga0307405_10882659 3300031731 Bacteria 755
66 Ga0307416_100191397 3300032002 Bacteria 1930
67 Ga0307415_100100561 3300032126 Bacteria 2119
68 Ga0316580_10021412 3300032139 Unclassified 1993
69 Ga0373951_0085284 3300035091 Bacteria 822
70 Ga0373952_0078287 3300035092 Bacteria 839
71 Ga0373943_0203218 3300035170 Bacteria 1097
72 Ga0373946_0262575 3300035171 Unclassified 845
73 Ga0373955_0333098 3300035172 Bacteria 918
74 Ga0316574_0013152 3300035398 Bacteria 4753
75 Ga0316574_0014381 3300035398 Bacteria 4573
76 Ga0316574_0074180 3300035398 Bacteria 2153
77 Ga0316574_0377880 3300035398 Bacteria 894
78 Ga0373947_0036990 3300035725 Bacteria 2896
79 Ga0316582_0162183 3300036647 Unclassified 1515
80 Ga0316584_0172553 3300036712 Bacteria 1603
81 Ga0316584_0351938 3300036712 Bacteria 1057
82 Ga0316584_0388802 3300036712 Bacteria 996
83 Ga0400483_262549 3300039062 Bacteria 6695
84 Ga0436365_1736945 3300039437 Bacteria 904
85 Ga0436363_0597663 3300039450 Bacteria 1062
86 Ga0451791_1414075 3300041451 Bacteria 1850
87 Ga0451843_0042200 3300041509 Bacteria 780
88 Ga0451853_0987944 3300041512 Unclassified 646
89 Ga0451853_1119589 3300041512 Bacteria 2570
90 Ga0439434_0019255 3300042435 Bacteria 2047
91 Ga0495603_0306778 3300046455 Bacteria 912
92 Ga0495629_0129267 3300046459 Bacteria 1760
93 Ga0495653_0326026 3300046463 Bacteria 994
94 Ga0495653_0620283 3300046463 Bacteria 663
95 Ga0495594_0123631 3300046499 Bacteria 1463
96 Ga0495630_0272644 3300046517 Bacteria 1293
97 Ga0495640_0176388 3300046533 Bacteria 1364
98 Ga0495587_0312608 3300046536 Bacteria 878
99 Ga0495587_0314325 3300046536 Unclassified 875
100 Ga0495667_0812531 3300046559 Bacteria 576
101 Ga0495658_0017396 3300046683 Bacteria 3713
102 Ga0495613_0070428 3300046689 Bacteria 2550
103 Ga0495613_0266299 3300046689 Bacteria 1193
104 Ga0495676_0214742 3300047321 Bacteria 1329
105 Ga0495680_0026822 3300047322 Bacteria 4744
106 Ga0495684_0477472 3300047471 Bacteria 861
107 Ga0495602_0421426 3300048088 Unclassified 948
108 Ga0496102_0450907 3300048905 Bacteria 1207
109 Ga0496105_0020974 3300048908 Bacteria 5285
110 Ga0496110_0769770 3300048913 Bacteria 866
111 Ga0496114_0414348 3300048917 Bacteria 1193
112 Ga0496114_0834682 3300048917 Bacteria 801
113 Ga0501034_0000614 3300049571 Bacteria 56086
114 Ga0501034_0851509 3300049571 Unclassified 802
115 Ga0501047_0058281 3300049581 Bacteria 3731
116 Ga0501071_0065949 3300049587 Bacteria 2630
117 Ga0501073_0047640 3300049589 Bacteria 3012
118 Ga0501075_0185093 3300049591 Bacteria 1589
119 Ga0501035_0321601 3300049822 Bacteria 1300
120 Ga0501044_0001045 3300049823 Bacteria 33277
121 nmdc:mga00v17_117739_c2 3300050491 Unclassified 1081
122 nmdc:mga00v17_219273_c1 3300050491 Bacteria 1231
123 nmdc:mga0yw44_1007025_c1 3300050492 Bacteria 564
124 nmdc:mga0yw44_137095_c1 3300050492 Bacteria 1588
125 nmdc:mga0yw44_221447_c1 3300050492 Unclassified 1254
126 nmdc:mga0yw44_65308_c1 3300050492 Bacteria 2242
127 nmdc:mga06z11_647411_c1 3300050494 Bacteria 643
128 nmdc:mga06z11_89486_c1 3300050494 Bacteria 1668
129 nmdc:mga06z11_95091_c1 3300050494 Bacteria 1625
130 nmdc:mga04h51_37413_c1 3300050495 Bacteria 1566
131 nmdc:mga07m45_103752_c1 3300050496 Unclassified 1634
132 nmdc:mga06r32_67123_c1 3300050510 Bacteria 3462
133 Ga0495601_0264134 3300053077 Bacteria 1123
134 Ga0495612_0146205 3300053078 Bacteria 1027
135 Ga0495595_0177154 3300053084 Unclassified 1056
136 Ga0495595_0370397 3300053084 Bacteria 724
137 Ga0500566_0000146 3300053094 Bacteria 36277
138 Ga0500616_0000201 3300053153 Bacteria 97711
139 Ga0495630_0640389
140 Ga0065704_10205838
141 Ga0070668_100804520
142 Ga0070688_100910129
143 Ga0070681_11195974
144 Ga0068855_100092253
145 Ga0068857_100652657
146 Ga0068856_100013764
147 Ga0068864_100046801
148 Ga0068861_101362406
149 Ga0068863_101043834
150 Ga0068863_101544652
151 Ga0068860_100031304
152 Ga0068860_100064259
153 Ga0075365_10047901
154 Ga0075365_10113637
155 Ga0075365_10146155
156 Ga0075363_100019097
157 Ga0075363_100022880
158 Ga0075363_100392247
159 Ga0075364_10018671
160 Ga0075364_10151453
161 Ga0075364_10177407
162 Ga0075364_10208301
163 Ga0075364_10285406
164 Ga0070712_100155581
165 Ga0075367_10031108
166 Ga0075367_10241521
167 Ga0075367_10299378
168 Ga0075367_10524232
169 Ga0075431_100069280
170 Ga0068865_100298461
171 Ga0105240_10035458
172 Ga0111539_12101612
173 Ga0105243_11080994
174 Ga0105248_10199449
175 Ga0105249_10028070
176 Ga0157374_11029108
177 Ga0157372_10586220
178 Ga0157375_11546338
179 Ga0163163_10109320
180 Ga0163163_10346907
181 Ga0157379_10345087
182 Ga0207695_10168490
183 Ga0207706_11200274
184 Ga0207704_10530003
185 Ga0207711_10100329
186 Ga0207689_10751825
187 Ga0207667_10034511
188 Ga0207667_10152263
189 Ga0207712_10097755
190 Ga0207712_10488056
191 Ga0207668_10759386
192 Ga0207702_10017446
193 Ga0207648_10931804
194 Ga0268264_10076056
195 Ga0268264_10555766
196 Ga0265331_10270040
197 Ga0265327_10000008
198 Ga0265327_10000489
199 Ga0265327_10028270
200 Ga0316579_10200115
201 Ga0316576_10057043
202 Ga0316578_10146083
203 Ga0307405_10882659
204 Ga0307416_100191397
205 Ga0307415_100100561
206 Ga0316580_10021412
207 Ga0373951_0085284
208 Ga0373952_0078287
209 Ga0373943_0203218
210 Ga0373946_0262575
211 Ga0373955_0333098
212 Ga0316574_0013152
213 Ga0316574_0014381
214 Ga0316574_0074180
215 Ga0316574_0377880
216 Ga0373947_0036990
217 Ga0316582_0162183
218 Ga0316584_0172553
219 Ga0316584_0351938
220 Ga0316584_0388802
221 Ga0400483_262549
222 Ga0436365_1736945
223 Ga0436363_0597663
224 Ga0451791_1414075
225 Ga0451843_0042200
226 Ga0451853_0987944
227 Ga0451853_1119589
228 Ga0439434_0019255
229 Ga0495603_0306778
230 Ga0495629_0129267
231 Ga0495653_0326026
232 Ga0495653_0620283
233 Ga0495594_0123631
234 Ga0495630_0272644
235 Ga0495640_0176388
236 Ga0495587_0312608
237 Ga0495587_0314325
238 Ga0495667_0812531
239 Ga0495658_0017396
240 Ga0495613_0070428
241 Ga0495613_0266299
242 Ga0495676_0214742
243 Ga0495680_0026822
244 Ga0495684_0477472
245 Ga0495602_0421426
246 Ga0496102_0450907
247 Ga0496105_0020974
248 Ga0496110_0769770
249 Ga0496114_0414348
250 Ga0496114_0834682
251 Ga0501034_0000614
252 Ga0501034_0851509
253 Ga0501047_0058281
254 Ga0501071_0065949
255 Ga0501073_0047640
256 Ga0501075_0185093
257 Ga0501035_0321601
258 Ga0501044_0001045
259 nmdc:mga00v17_117739_c2
260 nmdc:mga00v17_219273_c1
261 nmdc:mga0yw44_1007025_c1
262 nmdc:mga0yw44_137095_c1
263 nmdc:mga0yw44_221447_c1
264 nmdc:mga0yw44_65308_c1
265 nmdc:mga06z11_647411_c1
266 nmdc:mga06z11_89486_c1
267 nmdc:mga06z11_95091_c1
268 nmdc:mga04h51_37413_c1
269 nmdc:mga07m45_103752_c1
270 nmdc:mga06r32_67123_c1
271 Ga0495601_0264134
272 Ga0495612_0146205
273 Ga0495595_0177154
274 Ga0495595_0370397
275 Ga0500566_0000146
276 Ga0500616_0000201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8an5-assembly1.cif.gz_B menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.721 7 175
8an4-assembly2.cif.gz_B ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv 0.7197 7 176
8an4-assembly1.cif.gz_A ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv 0.7192 2 179
8an5-assembly1.cif.gz_A menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.7164 7 178
8an4-assembly1.cif.gz_A ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv 0.7123 2 179
ID Description Score Start End Superfamily
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.7981 1 144 3.30.460.40
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.7282 1 144 3.30.460.40
af_F4HUW0_97_242_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6882 7 98 3.30.460.10
5n16D01 Mainly Alpha;Up-down Bundle;Histone Acetyltransferase; Chain A;Bromodomain-like 0.6842 151 178 1.20.920.10
1uevA02 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6672 4 94 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A538CS74-F1-model_v4 Nucleotidyltransferase family protein 0.9907 1 178
AF-A0A6I3A6H6-F1-model_v4 Nucleotidyltransferase family protein 0.99 1 176
AF-A0A812ZHT8-F1-model_v4 deleted 0.9833 4 178
AF-A0A6L7MTY8-F1-model_v4 Nucleotidyl transferase AbiEii/AbiGii toxin family protein 0.9806 3 178
AF-A0A538CS74-F1-model_v4 Nucleotidyltransferase family protein 0.9798 1 178

Map