F166507

General Info

Members Datasets Scaffolds Average Seq Length
136 110 136 239

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10000178|Ga0105249_1000017839
Length 261
Sequence MTRRAELASIYLRIGRTYWRWAPSLLLLAVLVFVPLGLIHALTLEADIGSFDLDNGLRLFAIVGAVLALAATGLVGEVFYTGAVSILLTHPHDGEPPSMRETAGMIKYRPLIAIDLLYGFAVAVGLIFFFIPGVLVFVWLGLTAPVVEIEHRGIRAAFRRSVELVRHKFWIVALVLIPIELIGDAMTNLATAATHGLFGSEFICEWLADVLANIAFTPFYAVAAVLLTVDLIREKGGGVELHPAPVPGDGRARVAPTPPLP

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
32 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
55 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
56 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
57 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
58 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
59 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
60 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
61 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
62 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
63 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
64 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
65 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
66 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
67 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
68 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
69 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
70 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
71 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
72 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
73 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
74 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
75 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
76 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
77 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
78 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
79 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
80 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
81 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
82 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
86 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
87 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
88 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
89 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
94 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
107 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
108 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
110 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0
Rhizoplane 12.5
Rhizosphere 83.82
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10000015 3300005333 Bacteria 52793
2 Ga0070680_100026105 3300005336 Bacteria 4672
3 Ga0070682_100000052 3300005337 Bacteria 118879
4 Ga0070674_100000007 3300005356 Bacteria 145531
5 Ga0070673_100000923 3300005364 Bacteria 16611
6 Ga0070659_100026085 3300005366 Bacteria 4495
7 Ga0070711_100110299 3300005439 Bacteria 2019
8 Ga0070662_100000002 3300005457 Bacteria 253208
9 Ga0070681_10033452 3300005458 Bacteria 5161
10 Ga0068867_100024422 3300005459 Bacteria 4331
11 Ga0070679_100000913 3300005530 Bacteria 25634
12 Ga0070684_100068800 3300005535 Bacteria 3113
13 Ga0068853_100221258 3300005539 Bacteria 1729
14 Ga0070693_100000470 3300005547 Bacteria 18108
15 Ga0070665_100000141 3300005548 Bacteria 135473
16 Ga0068856_100011418 3300005614 Bacteria 8616
17 Ga0068866_10000003 3300005718 Bacteria 281675
18 Ga0068863_100000022 3300005841 Bacteria 188278
19 Ga0068858_100000118 3300005842 Bacteria 83359
20 Ga0075365_10155583 3300006038 Bacteria 1591
21 Ga0070715_10000029 3300006163 Bacteria 88994
22 Ga0075433_10000861 3300006852 Bacteria 21257
23 Ga0105240_10490366 3300009093 Bacteria 1368
24 Ga0105245_10000517 3300009098 Bacteria 35353
25 Ga0105245_10001897 3300009098 Bacteria 18995
26 Ga0105249_10000178 3300009553 Bacteria 74768
27 Ga0105249_10089482 3300009553 Bacteria 2877
28 Ga0157374_10000268 3300013296 Bacteria 48268
29 Ga0157374_10029528 3300013296 Bacteria 4967
30 Ga0157375_10333668 3300013308 Unclassified 1681
31 Ga0163163_10338160 3300014325 Bacteria 1560
32 Ga0157380_10000236 3300014326 Bacteria 33220
33 Ga0157379_10002058 3300014968 Bacteria 16705
34 Ga0163161_10000022 3300017792 Bacteria 207890
35 Ga0207682_10000155 3300025893 Bacteria 31180
36 Ga0207642_10000002 3300025899 Bacteria 658166
37 Ga0207685_10000031 3300025905 Bacteria 77451
38 Ga0207707_10033886 3300025912 Bacteria 4469
39 Ga0207663_10032616 3300025916 Bacteria 3094
40 Ga0207660_10018577 3300025917 Bacteria 4636
41 Ga0207652_10003850 3300025921 Bacteria 12292
42 Ga0207687_10000085 3300025927 Bacteria 68919
43 Ga0207687_10000756 3300025927 Bacteria 21840
44 Ga0207690_10241700 3300025932 Unclassified 1391
45 Ga0207706_10000001 3300025933 Bacteria 423014
46 Ga0207669_10000001 3300025937 Bacteria 377747
47 Ga0207651_10001845 3300025960 Bacteria 9894
48 Ga0207712_10000118 3300025961 Bacteria 85518
49 Ga0207703_10000061 3300026035 Bacteria 132671
50 Ga0207708_10063291 3300026075 Bacteria 2826
51 Ga0207702_10064452 3300026078 Bacteria 3136
52 Ga0207641_10000016 3300026088 Bacteria 307363
53 Ga0207648_10036620 3300026089 Bacteria 4322
54 Ga0207698_10023560 3300026142 Bacteria 4302
55 Ga0268266_10000056 3300028379 Bacteria 289176
56 Ga0451853_0066269 3300041512 Bacteria 5213
57 Ga0466963_0000004 3300044694 Bacteria 102526
58 Ga0495592_0011666 3300046454 Bacteria 6654
59 Ga0495592_0090460 3300046454 Bacteria 2196
60 Ga0495603_0000305 3300046455 Bacteria 26162
61 Ga0495603_0009899 3300046455 Bacteria 5770
62 Ga0495641_0000005 3300046461 Bacteria 206626
63 Ga0495653_0150872 3300046463 Unclassified 1624
64 Ga0495582_0000001 3300046473 Bacteria 252434
65 Ga0495662_0000001 3300046476 Bacteria 179185
66 Ga0495608_0001804 3300046511 Bacteria 15293
67 Ga0495618_0000014 3300046514 Bacteria 163136
68 Ga0495620_0000972 3300046515 Bacteria 17645
69 Ga0495628_0011957 3300046516 Bacteria 7320
70 Ga0495628_0101261 3300046516 Bacteria 2223
71 Ga0495630_0000256 3300046517 Bacteria 42987
72 Ga0495630_0006055 3300046517 Bacteria 8568
73 Ga0495630_0054889 3300046517 Bacteria 2985
74 Ga0495630_0188522 3300046517 Bacteria 1573
75 Ga0495652_0000010 3300046529 Bacteria 261584
76 Ga0495652_0003765 3300046529 Bacteria 14828
77 Ga0495640_0144628 3300046533 Unclassified 1530
78 Ga0495586_0000083 3300046535 Bacteria 57851
79 Ga0495587_0118285 3300046536 Bacteria 1518
80 Ga0495598_0000128 3300046537 Bacteria 12760
81 Ga0495621_0004348 3300046539 Bacteria 3977
82 Ga0495645_0040001 3300046543 Bacteria 3420
83 Ga0495634_0084167 3300046642 Unclassified 2074
84 Ga0495635_0000031 3300046663 Bacteria 110244
85 Ga0495657_0004304 3300046675 Bacteria 11367
86 Ga0495599_0028539 3300046678 Bacteria 3498
87 Ga0495623_0150636 3300046679 Unclassified 1375
88 Ga0495647_0000001 3300046681 Bacteria 222371
89 Ga0495647_0067776 3300046681 Bacteria 1422
90 Ga0495658_0000002 3300046683 Bacteria 309651
91 Ga0495669_0000076 3300046684 Bacteria 65203
92 Ga0495613_0000005 3300046689 Bacteria 222558
93 Ga0495624_0000019 3300046690 Bacteria 102237
94 Ga0495624_0007669 3300046690 Bacteria 7575
95 Ga0495624_0071981 3300046690 Bacteria 2151
96 Ga0495670_0040571 3300046691 Bacteria 2321
97 Ga0495649_0003116 3300046694 Bacteria 11358
98 Ga0495600_0017879 3300046809 Bacteria 4512
99 Ga0495604_0361576 3300047317 Unclassified 962
100 Ga0495676_0000238 3300047321 Bacteria 44160
101 Ga0495676_0436488 3300047321 Unclassified 865
102 Ga0495680_0000143 3300047322 Bacteria 71946
103 Ga0495680_0000488 3300047322 Bacteria 44631
104 Ga0495680_0107811 3300047322 Bacteria 2068
105 Ga0495602_0019367 3300048088 Bacteria 6758
106 Ga0495602_0120364 3300048088 Unclassified 2113
107 Ga0496100_0000059 3300048903 Bacteria 65518
108 Ga0496101_0000135 3300048904 Bacteria 65518
109 Ga0496101_0374383 3300048904 Bacteria 1120
110 Ga0496104_0000025 3300048907 Bacteria 228519
111 Ga0496105_0000023 3300048908 Bacteria 156126
112 Ga0496105_0063371 3300048908 Bacteria 3050
113 Ga0496106_0000030 3300048909 Bacteria 136804
114 Ga0496106_0000252 3300048909 Bacteria 37666
115 Ga0496107_0000054 3300048910 Bacteria 60902
116 Ga0496107_0052007 3300048910 Bacteria 2955
117 Ga0496108_0000006 3300048911 Bacteria 469473
118 Ga0496109_0000009 3300048912 Bacteria 236561
119 Ga0496110_0006585 3300048913 Bacteria 9226
120 Ga0496112_0000025 3300048915 Bacteria 146197
121 Ga0496113_0027027 3300048916 Bacteria 4109
122 Ga0496113_0149263 3300048916 Unclassified 1843
123 Ga0496114_0006763 3300048917 Bacteria 9033
124 Ga0496125_0052439 3300048928 Bacteria 3354
125 Ga0501042_0236692 3300049578 Bacteria 1317
126 Ga0501071_0114299 3300049587 Bacteria 1997
127 Ga0501075_0001595 3300049591 Bacteria 14844
128 nmdc:mga0yw44_168689_c1 3300050492 Bacteria 1436
129 nmdc:mga0a205_53_c2 3300050515 Bacteria 54696
130 Ga0495601_0000158 3300053077 Bacteria 37317
131 Ga0495601_0287687 3300053077 Unclassified 1071
132 Ga0495595_0000045 3300053084 Bacteria 63054
133 Ga0495619_0002874 3300053085 Bacteria 11197
134 Ga0495619_0005581 3300053085 Bacteria 7983
135 Ga0495619_0011332 3300053085 Bacteria 5612
136 Ga0500614_000427 3300053123 Bacteria 10952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100000052 Ga0070682_10000005264 212
2 3300053077 Ga0495601_0000158 Ga0495601_0000158_2309_3052 212
3 3300046517 Ga0495630_0188522 Ga0495630_0188522_490_1239 214
4 3300046690 Ga0495624_0071981 Ga0495624_0071981_118_867 214
5 3300053077 Ga0495601_0287687 Ga0495601_0287687_90_839 214
6 3300053085 Ga0495619_0011332 Ga0495619_0011332_387_1136 214
7 3300046539 Ga0495621_0004348 Ga0495621_0004348_1460_2206 216
8 3300046517 Ga0495630_0006055 Ga0495630_0006055_5644_6423 217
9 3300005535 Ga0070684_100068800 Ga0070684_1000688005 218
10 3300005539 Ga0068853_100221258 Ga0068853_1002212584 220
11 3300048917 Ga0496114_0006763 Ga0496114_0006763_878_1621 220
12 3300046675 Ga0495657_0004304 Ga0495657_0004304_4404_5144 222
13 3300046690 Ga0495624_0007669 Ga0495624_0007669_5662_6402 222
14 3300006852 Ga0075433_10000861 Ga0075433_100008612 223
15 3300046689 Ga0495613_0000005 Ga0495613_0000005_132598_133338 223
16 3300050515 nmdc:mga0a205_53_c2 nmdc:mga0a205_53_c2_33857_34597 223
17 3300041512 Ga0451853_0066269 Ga0451853_0066269_2108_2851 224
18 3300046454 Ga0495592_0090460 Ga0495592_0090460_941_1723 226
19 3300046463 Ga0495653_0150872 Ga0495653_0150872_305_1087 226
20 3300048913 Ga0496110_0006585 Ga0496110_0006585_7578_8321 226
21 3300006038 Ga0075365_10155583 Ga0075365_101555832 227
22 3300050492 nmdc:mga0yw44_168689_c1 nmdc:mga0yw44_168689_c1_347_1090 227
23 3300005548 Ga0070665_100000141 Ga0070665_100000141108 228
24 3300005842 Ga0068858_100000118 Ga0068858_10000011859 228
25 3300009098 Ga0105245_10001897 Ga0105245_1000189721 228
26 3300013296 Ga0157374_10000268 Ga0157374_1000026842 228
27 3300013296 Ga0157374_10029528 Ga0157374_100295285 228
28 3300025927 Ga0207687_10000756 Ga0207687_1000075616 228
29 3300026035 Ga0207703_10000061 Ga0207703_1000006176 228
30 3300028379 Ga0268266_10000056 Ga0268266_10000056115 228
31 3300046684 Ga0495669_0000076 Ga0495669_0000076_34124_34867 228
32 3300048915 Ga0496112_0000025 Ga0496112_0000025_133796_134542 228
33 3300013308 Ga0157375_10333668 Ga0157375_103336683 229
34 3300048904 Ga0496101_0374383 Ga0496101_0374383_167_910 229
35 3300048911 Ga0496108_0000006 Ga0496108_0000006_414098_414883 229
36 3300048912 Ga0496109_0000009 Ga0496109_0000009_181186_181971 229
37 3300048928 Ga0496125_0052439 Ga0496125_0052439_2063_2848 229
38 3300049578 Ga0501042_0236692 Ga0501042_0236692_297_1040 229
39 3300046514 Ga0495618_0000014 Ga0495618_0000014_81210_81944 230
40 3300046809 Ga0495600_0017879 Ga0495600_0017879_2787_3521 230
41 3300026075 Ga0207708_10063291 Ga0207708_100632911 231
42 3300046517 Ga0495630_0000256 Ga0495630_0000256_3925_4674 231
43 3300046535 Ga0495586_0000083 Ga0495586_0000083_19136_19918 231
44 3300047321 Ga0495676_0436488 Ga0495676_0436488_66_812 233
45 3300046454 Ga0495592_0011666 Ga0495592_0011666_3261_4007 234
46 3300046516 Ga0495628_0101261 Ga0495628_0101261_1445_2185 234
47 3300046529 Ga0495652_0000010 Ga0495652_0000010_248298_249026 234
48 3300048916 Ga0496113_0027027 Ga0496113_0027027_2678_3424 234
49 3300014326 Ga0157380_10000236 Ga0157380_1000023623 235
50 3300046476 Ga0495662_0000001 Ga0495662_0000001_45516_46256 235
51 3300046678 Ga0495599_0028539 Ga0495599_0028539_1731_2474 235
52 3300046691 Ga0495670_0040571 Ga0495670_0040571_916_1659 235
53 3300046517 Ga0495630_0054889 Ga0495630_0054889_1784_2533 236
54 3300046533 Ga0495640_0144628 Ga0495640_0144628_511_1251 236
55 3300046642 Ga0495634_0084167 Ga0495634_0084167_972_1712 236
56 3300048909 Ga0496106_0000030 Ga0496106_0000030_12560_13303 236
57 3300048910 Ga0496107_0052007 Ga0496107_0052007_2168_2911 236
58 3300044694 Ga0466963_0000004 Ga0466963_0000004_89023_89781 237
59 3300046455 Ga0495603_0009899 Ga0495603_0009899_671_1414 237
60 3300005457 Ga0070662_100000002 Ga0070662_100000002205 238
61 3300005459 Ga0068867_100024422 Ga0068867_1000244222 238
62 3300005841 Ga0068863_100000022 Ga0068863_10000002213 238
63 3300025933 Ga0207706_10000001 Ga0207706_10000001386 238
64 3300026088 Ga0207641_10000016 Ga0207641_10000016134 238
65 3300026089 Ga0207648_10036620 Ga0207648_100366207 238
66 3300005364 Ga0070673_100000923 Ga0070673_1000009238 239
67 3300025960 Ga0207651_10001845 Ga0207651_100018455 239
68 3300046516 Ga0495628_0011957 Ga0495628_0011957_1405_2145 239
69 3300047322 Ga0495680_0000143 Ga0495680_0000143_38589_39329 239
70 3300053085 Ga0495619_0002874 Ga0495619_0002874_6840_7631 239
71 3300005614 Ga0068856_100011418 Ga0068856_10001141810 240
72 3300026078 Ga0207702_10064452 Ga0207702_100644523 240
73 3300046515 Ga0495620_0000972 Ga0495620_0000972_1122_1865 240
74 3300005547 Ga0070693_100000470 Ga0070693_10000047012 241
75 3300046690 Ga0495624_0000019 Ga0495624_0000019_27435_28274 241
76 3300048907 Ga0496104_0000025 Ga0496104_0000025_34389_35171 241
77 3300048908 Ga0496105_0000023 Ga0496105_0000023_34389_35171 241
78 3300014968 Ga0157379_10002058 Ga0157379_1000205810 242
79 3300005356 Ga0070674_100000007 Ga0070674_100000007128 243
80 3300005718 Ga0068866_10000003 Ga0068866_10000003270 243
81 3300025899 Ga0207642_10000002 Ga0207642_10000002520 243
82 3300025937 Ga0207669_10000001 Ga0207669_1000000122 243
83 3300017792 Ga0163161_10000022 Ga0163161_1000002218 246
84 3300046511 Ga0495608_0001804 Ga0495608_0001804_2263_3003 246
85 3300053084 Ga0495595_0000045 Ga0495595_0000045_46977_47717 246
86 3300005336 Ga0070680_100026105 Ga0070680_1000261054 247
87 3300005366 Ga0070659_100026085 Ga0070659_1000260852 247
88 3300005439 Ga0070711_100110299 Ga0070711_1001102992 247
89 3300005458 Ga0070681_10033452 Ga0070681_100334526 247
90 3300005530 Ga0070679_100000913 Ga0070679_10000091314 247
91 3300006163 Ga0070715_10000029 Ga0070715_1000002924 247
92 3300009093 Ga0105240_10490366 Ga0105240_104903661 247
93 3300009553 Ga0105249_10089482 Ga0105249_100894823 247
94 3300014325 Ga0163163_10338160 Ga0163163_103381602 247
95 3300025905 Ga0207685_10000031 Ga0207685_1000003165 247
96 3300025912 Ga0207707_10033886 Ga0207707_100338867 247
97 3300025916 Ga0207663_10032616 Ga0207663_100326162 247
98 3300025917 Ga0207660_10018577 Ga0207660_100185775 247
99 3300025921 Ga0207652_10003850 Ga0207652_1000385014 247
100 3300025932 Ga0207690_10241700 Ga0207690_102417002 247
101 3300026142 Ga0207698_10023560 Ga0207698_100235602 247
102 3300046461 Ga0495641_0000005 Ga0495641_0000005_119306_120049 247
103 3300046473 Ga0495582_0000001 Ga0495582_0000001_52568_53311 247
104 3300046536 Ga0495587_0118285 Ga0495587_0118285_287_1030 247
105 3300046537 Ga0495598_0000128 Ga0495598_0000128_7198_7944 247
106 3300046543 Ga0495645_0040001 Ga0495645_0040001_358_1101 247
107 3300046663 Ga0495635_0000031 Ga0495635_0000031_80111_80857 247
108 3300046679 Ga0495623_0150636 Ga0495623_0150636_97_840 247
109 3300046681 Ga0495647_0000001 Ga0495647_0000001_37540_38283 247
110 3300046683 Ga0495658_0000002 Ga0495658_0000002_176174_176917 247
111 3300046694 Ga0495649_0003116 Ga0495649_0003116_3329_4072 247
112 3300047321 Ga0495676_0000238 Ga0495676_0000238_13316_14059 247
113 3300047322 Ga0495680_0000488 Ga0495680_0000488_37333_38076 247
114 3300047322 Ga0495680_0107811 Ga0495680_0107811_521_1264 247
115 3300048088 Ga0495602_0019367 Ga0495602_0019367_3707_4450 247
116 3300048088 Ga0495602_0120364 Ga0495602_0120364_645_1388 247
117 3300048916 Ga0496113_0149263 Ga0496113_0149263_945_1688 247
118 3300049587 Ga0501071_0114299 Ga0501071_0114299_809_1552 247
119 3300049591 Ga0501075_0001595 Ga0501075_0001595_249_1001 247
120 3300053123 Ga0500614_000427 Ga0500614_000427_4625_5368 247
121 3300046455 Ga0495603_0000305 Ga0495603_0000305_9666_10415 248
122 3300046681 Ga0495647_0067776 Ga0495647_0067776_87_836 248
123 3300048908 Ga0496105_0063371 Ga0496105_0063371_1328_2077 248
124 3300053085 Ga0495619_0005581 Ga0495619_0005581_112_861 248
125 3300046529 Ga0495652_0003765 Ga0495652_0003765_2693_3448 249
126 3300048903 Ga0496100_0000059 Ga0496100_0000059_19538_20290 249
127 3300048904 Ga0496101_0000135 Ga0496101_0000135_45229_45981 249
128 3300048909 Ga0496106_0000252 Ga0496106_0000252_14876_15628 249
129 3300048910 Ga0496107_0000054 Ga0496107_0000054_45229_45981 249
130 3300047317 Ga0495604_0361576 Ga0495604_0361576_55_861 253
131 3300005333 Ga0070677_10000015 Ga0070677_1000001544 260
132 3300009098 Ga0105245_10000517 Ga0105245_1000051717 260
133 3300009553 Ga0105249_10000178 Ga0105249_1000017839 260
134 3300025893 Ga0207682_10000155 Ga0207682_1000015516 260
135 3300025927 Ga0207687_10000085 Ga0207687_1000008552 260
136 3300025961 Ga0207712_10000118 Ga0207712_1000011839 260

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wwb-assembly1.cif.gz_B choline transporter-like protein 1 0.5443 5 242
7wwb-assembly1.cif.gz_B choline transporter-like protein 1 0.5061 5 242
3tx3-assembly1.cif.gz_B cysz, a putative sulfate permease 0.3957 10 235
3tx3-assembly1.cif.gz_B cysz, a putative sulfate permease 0.3825 10 235
4kly-assembly1.cif.gz_D crystal structure of a blue-light absorbing proteorhodopsin mutant d97n from hot75 0.3397 49 235
ID Description Score Start End Superfamily
af_A0A1D6PCH9_40_269_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5825 50 227 1.50.40.10
af_A0A0R0IWF6_9_267_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5668 60 235 1.50.40.10
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5306 7 236 1.20.1070.10
af_Q12375_14_292_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5155 62 234 1.50.40.10
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4774 7 236 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A1Q3NKT4-F1-model_v4 deleted 0.9182 5 245
AF-A0A538A963-F1-model_v4 Glycerophosphoryl diester phosphodiesterase membrane domain-containing protein 0.8777 7 235 GO:0016020
AF-A0A524JAG5-F1-model_v4 Glycerophosphoryl diester phosphodiesterase membrane domain-containing protein 0.8776 1 248 GO:0016020
AF-A0A524JAG5-F1-model_v4 Glycerophosphoryl diester phosphodiesterase membrane domain-containing protein 0.8742 1 248 GO:0016020
AF-A0A7V4G1B7-F1-model_v4 Glycerophosphoryl diester phosphodiesterase membrane domain-containing protein 0.853 5 236 GO:0016020

Feature Viewer

pLDDT pTM Quality
78.65 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map