F153385

General Info

Members Datasets Scaffolds Average Seq Length
132 114 132 69

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_101401215|Ga0307409_1014012152
Length 78
Sequence MTPQNTRQDRSHALRQVAKAANRRQRADDSRREATAELREWCRRAHDAGITITEIAGVAGLSRQGVYDLLSQPPAQRA

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
65 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
66 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
67 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
68 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
78 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
79 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
80 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
81 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
85 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
86 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
87 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
88 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
89 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
90 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
100 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
103 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 10.61
Rhizosphere 81.06
Stem 0
Stem Tuber 0
Unclassified 6.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10000072 3300003659 Bacteria 9060
2 Ga0070683_100000367 3300005329 Bacteria 31252
3 Ga0070683_101001390 3300005329 Bacteria 802
4 Ga0070690_100893554 3300005330 Bacteria 694
5 Ga0070677_10000013 3300005333 Bacteria 53677
6 Ga0068869_100214411 3300005334 Bacteria 1523
7 Ga0070666_10058619 3300005335 Unclassified 2604
8 Ga0068868_100011787 3300005338 Bacteria 6373
9 Ga0070691_10000012 3300005341 Bacteria 56648
10 Ga0070674_100000019 3300005356 Bacteria 89350
11 Ga0070688_100000069 3300005365 Bacteria 50704
12 Ga0070667_100529121 3300005367 Unclassified 1082
13 Ga0070714_100849279 3300005435 Bacteria 885
14 Ga0070678_101726531 3300005456 Unclassified 589
15 Ga0070678_102074532 3300005456 Unclassified 538
16 Ga0070685_10000024 3300005466 Bacteria 101602
17 Ga0070684_100001932 3300005535 Bacteria 15203
18 Ga0070672_100000058 3300005543 Bacteria 49964
19 Ga0070695_100054543 3300005545 Bacteria 2573
20 Ga0070696_101923226 3300005546 Unclassified 513
21 Ga0070665_102048946 3300005548 Unclassified 577
22 Ga0070704_100416026 3300005549 Bacteria 1150
23 Ga0068855_100467467 3300005563 Unclassified 1374
24 Ga0068852_100043782 3300005616 Unclassified 3798
25 Ga0068866_10000005 3300005718 Bacteria 196339
26 Ga0068861_100885491 3300005719 Unclassified 844
27 Ga0068858_100000033 3300005842 Bacteria 142748
28 Ga0081540_1000296 3300005983 Bacteria 51895
29 Ga0075365_10915145 3300006038 Unclassified 618
30 Ga0068865_100000062 3300006881 Bacteria 57186
31 Ga0075435_100914839 3300007076 Bacteria 765
32 Ga0105240_11403585 3300009093 Unclassified 734
33 Ga0105241_10037678 3300009174 Bacteria 3643
34 Ga0105238_10588537 3300009551 Bacteria 1120
35 Ga0105239_11909250 3300010375 Unclassified 689
36 Ga0157338_1003778 3300012515 Bacteria 1275
37 Ga0157371_10001481 3300013102 Bacteria 24297
38 Ga0157371_10009289 3300013102 Bacteria 7751
39 Ga0157370_10015755 3300013104 Bacteria 7672
40 Ga0157370_11875113 3300013104 Unclassified 538
41 Ga0157374_10242323 3300013296 Bacteria 1773
42 Ga0163161_10000064 3300017792 Bacteria 108508
43 Ga0224712_10435779 3300022467 Bacteria 628
44 Ga0207682_10000038 3300025893 Bacteria 53885
45 Ga0207642_10000005 3300025899 Bacteria 401934
46 Ga0207680_10029465 3300025903 Unclassified 3084
47 Ga0207654_10026581 3300025911 Bacteria 3135
48 Ga0207695_10925274 3300025913 Unclassified 751
49 Ga0207694_10643572 3300025924 Unclassified 893
50 Ga0207664_10457374 3300025929 Bacteria 1140
51 Ga0207669_10000140 3300025937 Bacteria 34667
52 Ga0207704_10000045 3300025938 Bacteria 86589
53 Ga0207691_10000284 3300025940 Bacteria 49983
54 Ga0207689_10232543 3300025942 Bacteria 1523
55 Ga0207661_10000064 3300025944 Bacteria 75730
56 Ga0207661_10275387 3300025944 Bacteria 1503
57 Ga0207661_10459831 3300025944 Bacteria 1160
58 Ga0207640_10127079 3300025981 Bacteria 1837
59 Ga0207703_10001103 3300026035 Bacteria 25585
60 Ga0207702_10559955 3300026078 Unclassified 1119
61 Ga0207683_10347127 3300026121 Bacteria 1362
62 Ga0207698_10071037 3300026142 Bacteria 2761
63 Ga0268266_10000973 3300028379 Bacteria 36388
64 Ga0268266_11720331 3300028379 Unclassified 602
65 Ga0268264_10000725 3300028381 Bacteria 37821
66 Ga0307409_101401215 3300031995 Unclassified 725
67 Ga0307416_100015289 3300032002 Bacteria 5297
68 Ga0395900_0677826 3300037418 Unclassified 966
69 Ga0395898_0087686 3300037466 Unclassified 2998
70 Ga0395905_0569269 3300037471 Unclassified 1034
71 Ga0451798_0009133 3300041458 Bacteria 980
72 Ga0451802_0786587 3300041460 Unclassified 607
73 Ga0451807_0812240 3300041486 Bacteria 812
74 Ga0451833_0291626 3300041491 Unclassified 756
75 Ga0451845_0215226 3300041501 Unclassified 828
76 Ga0451853_1068761 3300041512 Bacteria 1149
77 Ga0466958_0825792 3300045836 Unclassified 604
78 Ga0466967_0000005 3300045976 Bacteria 149543
79 Ga0495638_0053432 3300046460 Bacteria 2514
80 Ga0495651_0163945 3300046462 Bacteria 1589
81 Ga0495651_0349692 3300046462 Bacteria 977
82 Ga0495618_0000094 3300046514 Bacteria 64293
83 Ga0495628_0002123 3300046516 Bacteria 17950
84 Ga0495628_0193188 3300046516 Bacteria 1536
85 Ga0495628_0549312 3300046516 Unclassified 829
86 Ga0495630_0027418 3300046517 Bacteria 4226
87 Ga0495644_0026524 3300046523 Bacteria 2198
88 Ga0495652_0000019 3300046529 Bacteria 190248
89 Ga0495640_0063611 3300046533 Bacteria 2498
90 Ga0495587_0288485 3300046536 Bacteria 919
91 Ga0495668_0043417 3300046616 Bacteria 2501
92 Ga0495634_0170584 3300046642 Bacteria 1367
93 Ga0495625_0754049 3300046660 Unclassified 570
94 Ga0495588_0007464 3300046674 Bacteria 4978
95 Ga0495588_0443121 3300046674 Bacteria 681
96 Ga0495646_0172219 3300046680 Bacteria 1192
97 Ga0495647_0029571 3300046681 Bacteria 2026
98 Ga0495624_0672381 3300046690 Unclassified 615
99 Ga0495600_0024463 3300046809 Unclassified 3888
100 Ga0495600_0083940 3300046809 Unclassified 2079
101 Ga0495581_0776607 3300047315 Bacteria 550
102 Ga0495676_0188910 3300047321 Bacteria 1438
103 Ga0495686_0677492 3300047472 Bacteria 528
104 Ga0495593_0188334 3300047673 Unclassified 1038
105 Ga0496100_1017727 3300048903 Unclassified 652
106 Ga0496108_0000004 3300048911 Bacteria 545055
107 Ga0496109_0000013 3300048912 Bacteria 227469
108 Ga0496110_0000122 3300048913 Bacteria 43513
109 Ga0496110_0086059 3300048913 Bacteria 2806
110 Ga0496110_0123830 3300048913 Bacteria 2331
111 Ga0496110_0159333 3300048913 Bacteria 2045
112 Ga0496110_1099116 3300048913 Unclassified 703
113 Ga0496111_0000037 3300048914 Bacteria 52978
114 Ga0496111_0375625 3300048914 Unclassified 1051
115 Ga0496113_0059702 3300048916 Bacteria 2873
116 Ga0496120_0032105 3300048923 Bacteria 3170
117 Ga0496121_0022405 3300048924 Bacteria 6133
118 Ga0496124_0243129 3300048927 Unclassified 1337
119 Ga0496125_0150428 3300048928 Unclassified 1600
120 Ga0496126_0177307 3300048929 Bacteria 1812
121 Ga0501033_0978230 3300049570 Unclassified 566
122 Ga0501034_0015251 3300049571 Bacteria 7897
123 Ga0501042_0088857 3300049578 Bacteria 2217
124 Ga0501047_0487261 3300049581 Bacteria 1060
125 Ga0501047_0987383 3300049581 Unclassified 655
126 Ga0501068_0373216 3300049584 Bacteria 918
127 Ga0501070_0228215 3300049586 Unclassified 1526
128 Ga0501083_0005584 3300049744 Bacteria 8906
129 Ga0501044_0030592 3300049823 Bacteria 5673
130 nmdc:mga0yw44_1053386_c1 3300050492 Unclassified 550
131 Ga0495601_0000196 3300053077 Bacteria 32072
132 Ga0500627_0197641 3300053158 Bacteria 902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10242323 Ga0157374_102423232 60
2 3300041460 Ga0451802_0786587 Ga0451802_0786587_89_298 60
3 3300013102 Ga0157371_10009289 Ga0157371_100092896 61
4 3300046536 Ga0495587_0288485 Ga0495587_0288485_517_726 61
5 3300005543 Ga0070672_100000058 Ga0070672_10000005840 64
6 3300006881 Ga0068865_100000062 Ga0068865_10000006243 64
7 3300025938 Ga0207704_10000045 Ga0207704_1000004563 64
8 3300025940 Ga0207691_10000284 Ga0207691_1000028439 64
9 3300048913 Ga0496110_0000122 Ga0496110_0000122_27744_27938 64
10 3300048914 Ga0496111_0000037 Ga0496111_0000037_15955_16149 64
11 3300005549 Ga0070704_100416026 Ga0070704_1004160262 66
12 3300009551 Ga0105238_10588537 Ga0105238_105885372 66
13 3300025924 Ga0207694_10643572 Ga0207694_106435721 66
14 3300005330 Ga0070690_100893554 Ga0070690_1008935542 67
15 3300005333 Ga0070677_10000013 Ga0070677_1000001329 67
16 3300005341 Ga0070691_10000012 Ga0070691_1000001234 67
17 3300005356 Ga0070674_100000019 Ga0070674_10000001928 67
18 3300005367 Ga0070667_100529121 Ga0070667_1005291212 67
19 3300005456 Ga0070678_101726531 Ga0070678_1017265312 67
20 3300005456 Ga0070678_102074532 Ga0070678_1020745321 67
21 3300005545 Ga0070695_100054543 Ga0070695_1000545432 67
22 3300005546 Ga0070696_101923226 Ga0070696_1019232261 67
23 3300005718 Ga0068866_10000005 Ga0068866_1000000557 67
24 3300005842 Ga0068858_100000033 Ga0068858_10000003310 67
25 3300009093 Ga0105240_11403585 Ga0105240_114035852 67
26 3300010375 Ga0105239_11909250 Ga0105239_119092502 67
27 3300012515 Ga0157338_1003778 Ga0157338_10037782 67
28 3300013104 Ga0157370_11875113 Ga0157370_118751132 67
29 3300017792 Ga0163161_10000064 Ga0163161_1000006458 67
30 3300025893 Ga0207682_10000038 Ga0207682_1000003829 67
31 3300025899 Ga0207642_10000005 Ga0207642_10000005260 67
32 3300025913 Ga0207695_10925274 Ga0207695_109252742 67
33 3300025937 Ga0207669_10000140 Ga0207669_1000014023 67
34 3300025981 Ga0207640_10127079 Ga0207640_101270794 67
35 3300026035 Ga0207703_10001103 Ga0207703_1000110317 67
36 3300026078 Ga0207702_10559955 Ga0207702_105599551 67
37 3300026121 Ga0207683_10347127 Ga0207683_103471271 67
38 3300028381 Ga0268264_10000725 Ga0268264_1000072516 67
39 3300041458 Ga0451798_0009133 Ga0451798_0009133_593_799 67
40 3300041501 Ga0451845_0215226 Ga0451845_0215226_569_781 67
41 3300046514 Ga0495618_0000094 Ga0495618_0000094_50190_50396 67
42 3300046516 Ga0495628_0002123 Ga0495628_0002123_10162_10368 67
43 3300046516 Ga0495628_0193188 Ga0495628_0193188_414_620 67
44 3300046516 Ga0495628_0549312 Ga0495628_0549312_30_236 67
45 3300046517 Ga0495630_0027418 Ga0495630_0027418_3690_3893 67
46 3300046523 Ga0495644_0026524 Ga0495644_0026524_1617_1823 67
47 3300046533 Ga0495640_0063611 Ga0495640_0063611_1910_2122 67
48 3300046616 Ga0495668_0043417 Ga0495668_0043417_1145_1357 67
49 3300046642 Ga0495634_0170584 Ga0495634_0170584_1124_1336 67
50 3300046674 Ga0495588_0443121 Ga0495588_0443121_28_240 67
51 3300046681 Ga0495647_0029571 Ga0495647_0029571_1504_1710 67
52 3300046809 Ga0495600_0024463 Ga0495600_0024463_2582_2788 67
53 3300047315 Ga0495581_0776607 Ga0495581_0776607_287_493 67
54 3300047321 Ga0495676_0188910 Ga0495676_0188910_404_616 67
55 3300048903 Ga0496100_1017727 Ga0496100_1017727_205_411 67
56 3300048911 Ga0496108_0000004 Ga0496108_0000004_413274_413477 67
57 3300048912 Ga0496109_0000013 Ga0496109_0000013_95715_95918 67
58 3300048913 Ga0496110_0086059 Ga0496110_0086059_2346_2558 67
59 3300048913 Ga0496110_1099116 Ga0496110_1099116_455_661 67
60 3300048916 Ga0496113_0059702 Ga0496113_0059702_194_400 67
61 3300048928 Ga0496125_0150428 Ga0496125_0150428_1143_1346 67
62 3300053077 Ga0495601_0000196 Ga0495601_0000196_24942_25154 67
63 3300037418 Ga0395900_0677826 Ga0395900_0677826_564_770 68
64 3300037466 Ga0395898_0087686 Ga0395898_0087686_1308_1514 68
65 3300037471 Ga0395905_0569269 Ga0395905_0569269_404_610 68
66 3300003659 JGI25404J52841_10000072 JGI25404J52841_100000725 69
67 3300005329 Ga0070683_100000367 Ga0070683_10000036722 69
68 3300005329 Ga0070683_101001390 Ga0070683_1010013902 69
69 3300005334 Ga0068869_100214411 Ga0068869_1002144112 69
70 3300005335 Ga0070666_10058619 Ga0070666_100586194 69
71 3300005338 Ga0068868_100011787 Ga0068868_1000117877 69
72 3300005365 Ga0070688_100000069 Ga0070688_10000006947 69
73 3300005435 Ga0070714_100849279 Ga0070714_1008492792 69
74 3300005466 Ga0070685_10000024 Ga0070685_1000002498 69
75 3300005535 Ga0070684_100001932 Ga0070684_10000193215 69
76 3300005548 Ga0070665_102048946 Ga0070665_1020489461 69
77 3300005563 Ga0068855_100467467 Ga0068855_1004674674 69
78 3300005616 Ga0068852_100043782 Ga0068852_1000437824 69
79 3300005719 Ga0068861_100885491 Ga0068861_1008854912 69
80 3300005983 Ga0081540_1000296 Ga0081540_100029637 69
81 3300006038 Ga0075365_10915145 Ga0075365_109151451 69
82 3300007076 Ga0075435_100914839 Ga0075435_1009148393 69
83 3300009174 Ga0105241_10037678 Ga0105241_100376782 69
84 3300013102 Ga0157371_10001481 Ga0157371_100014816 69
85 3300013104 Ga0157370_10015755 Ga0157370_100157557 69
86 3300022467 Ga0224712_10435779 Ga0224712_104357791 69
87 3300025903 Ga0207680_10029465 Ga0207680_100294654 69
88 3300025911 Ga0207654_10026581 Ga0207654_100265814 69
89 3300025929 Ga0207664_10457374 Ga0207664_104573742 69
90 3300025942 Ga0207689_10232543 Ga0207689_102325431 69
91 3300025944 Ga0207661_10000064 Ga0207661_1000006422 69
92 3300025944 Ga0207661_10275387 Ga0207661_102753872 69
93 3300025944 Ga0207661_10459831 Ga0207661_104598312 69
94 3300026142 Ga0207698_10071037 Ga0207698_100710371 69
95 3300028379 Ga0268266_10000973 Ga0268266_1000097320 69
96 3300028379 Ga0268266_11720331 Ga0268266_117203312 69
97 3300031995 Ga0307409_101401215 Ga0307409_1014012152 69
98 3300032002 Ga0307416_100015289 Ga0307416_1000152892 69
99 3300041486 Ga0451807_0812240 Ga0451807_0812240_31_240 69
100 3300041491 Ga0451833_0291626 Ga0451833_0291626_188_397 69
101 3300041512 Ga0451853_1068761 Ga0451853_1068761_293_502 69
102 3300045836 Ga0466958_0825792 Ga0466958_0825792_129_338 69
103 3300045976 Ga0466967_0000005 Ga0466967_0000005_14109_14318 69
104 3300046460 Ga0495638_0053432 Ga0495638_0053432_1280_1492 69
105 3300046462 Ga0495651_0163945 Ga0495651_0163945_530_739 69
106 3300046462 Ga0495651_0349692 Ga0495651_0349692_392_619 69
107 3300046529 Ga0495652_0000019 Ga0495652_0000019_77338_77553 69
108 3300046660 Ga0495625_0754049 Ga0495625_0754049_151_360 69
109 3300046674 Ga0495588_0007464 Ga0495588_0007464_3477_3686 69
110 3300046680 Ga0495646_0172219 Ga0495646_0172219_150_386 69
111 3300046690 Ga0495624_0672381 Ga0495624_0672381_140_349 69
112 3300046809 Ga0495600_0083940 Ga0495600_0083940_1586_1801 69
113 3300047472 Ga0495686_0677492 Ga0495686_0677492_124_336 69
114 3300047673 Ga0495593_0188334 Ga0495593_0188334_520_729 69
115 3300048913 Ga0496110_0123830 Ga0496110_0123830_1509_1718 69
116 3300048913 Ga0496110_0159333 Ga0496110_0159333_1589_1798 69
117 3300048914 Ga0496111_0375625 Ga0496111_0375625_375_584 69
118 3300048923 Ga0496120_0032105 Ga0496120_0032105_327_545 69
119 3300048924 Ga0496121_0022405 Ga0496121_0022405_2193_2402 69
120 3300048927 Ga0496124_0243129 Ga0496124_0243129_478_687 69
121 3300048929 Ga0496126_0177307 Ga0496126_0177307_638_847 69
122 3300049570 Ga0501033_0978230 Ga0501033_0978230_25_234 69
123 3300049571 Ga0501034_0015251 Ga0501034_0015251_4048_4257 69
124 3300049578 Ga0501042_0088857 Ga0501042_0088857_558_767 69
125 3300049581 Ga0501047_0487261 Ga0501047_0487261_702_911 69
126 3300049581 Ga0501047_0987383 Ga0501047_0987383_82_291 69
127 3300049584 Ga0501068_0373216 Ga0501068_0373216_72_281 69
128 3300049586 Ga0501070_0228215 Ga0501070_0228215_893_1102 69
129 3300049744 Ga0501083_0005584 Ga0501083_0005584_6609_6818 69
130 3300049823 Ga0501044_0030592 Ga0501044_0030592_3228_3437 69
131 3300050492 nmdc:mga0yw44_1053386_c1 nmdc:mga0yw44_1053386_c1_113_322 69
132 3300053158 Ga0500627_0197641 Ga0500627_0197641_678_887 69

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hno-assembly1.cif.gz_B archaeal transcription factor wild type 0.927 32 64
3iuo-assembly1.cif.gz_B the crystal structure of the c-terminal domain of the atp-dependent dna helicase recq from porphyromonas gingivalis to 1.6a 0.9223 29 64
7bhy-assembly2.cif.gz_C-2 dna-binding domain of deor in complex with the dna operator 0.9168 25 64
7bhy-assembly1.cif.gz_A dna-binding domain of deor in complex with the dna operator 0.9164 25 64
7bhy-assembly1.cif.gz_B dna-binding domain of deor in complex with the dna operator 0.9127 28 64
ID Description Score Start End Superfamily
2x48C00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8919 29 65 1.10.10.60
5f64B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8909 30 64 1.10.10.10
1r71B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;KorB DNA-binding domain 0.883 32 64 1.10.10.730
2w48B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8787 30 64 1.10.10.60
1r71C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;KorB DNA-binding domain 0.875 28 64 1.10.10.730
ID Description Score Start End GO Terms
AF-A0A1C9WXI8-F1-model_v4 Uncharacterized protein 0.9815 5 64
AF-A0A2A4RY34-F1-model_v4 Helix-turn-helix domain-containing protein 0.9795 19 64
AF-A0A1S9MJ40-F1-model_v4 Uncharacterized protein 0.9704 10 63
AF-A0A1I4DGM8-F1-model_v4 Homeodomain-like domain-containing protein 0.9682 28 64
AF-A0A7T0LLR0-F1-model_v4 Hin recombinase 0.9671 29 65 GO:0000150
GO:0003677

Feature Viewer

pLDDT pTM Quality
92.38 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map