F146299

General Info

Members Datasets Scaffolds Average Seq Length
130 85 260 169

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0261096|Ga0436364_0261096_6823_7371
Length 182
Sequence LRAEAAITTDDILTHMAIATQISVEEYLKTVYRPDCDYIDGLVEERNLGERDHAWMQARLVTFFMSRFRETGIAALPEWRFQVKPTRFRIPDVVLTRGKPDEQILTKPPLLCIEILSPEDTVSRLNERVRDYLDFGVPVVWVIDPVERRVWIYRTSGMEDATGEFIKLDDTTLEVPFSDIFD

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
75 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
76 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
77 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
78 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
79 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
80 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
81 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
82 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
83 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
84 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
85 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 2.31
Rhizosphere 78.46
Stem 0
Stem Tuber 0
Unclassified 26.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0261096 3300037853 Bacteria 8533
2 Ga0070680_100000953 3300005336 Bacteria 20481
3 Ga0070661_100141084 3300005344 Bacteria 1816
4 Ga0070661_100160736 3300005344 Bacteria 1701
5 Ga0070661_100620830 3300005344 Bacteria 875
6 Ga0070673_100513810 3300005364 Bacteria 1085
7 Ga0070659_100043484 3300005366 Bacteria 3513
8 Ga0070709_10023268 3300005434 Bacteria 3635
9 Ga0070714_100149771 3300005435 Bacteria 2102
10 Ga0070714_100385152 3300005435 Bacteria 1322
11 Ga0070713_100061238 3300005436 Bacteria 3148
12 Ga0070710_10191990 3300005437 Bacteria 1285
13 Ga0070711_100066654 3300005439 Bacteria 2523
14 Ga0070711_100502526 3300005439 Unclassified 1000
15 Ga0070678_100589455 3300005456 Bacteria 991
16 Ga0070678_101215743 3300005456 Unclassified 699
17 Ga0070685_10682575 3300005466 Unclassified 747
18 Ga0070697_100080784 3300005536 Bacteria 2679
19 Ga0068853_100003168 3300005539 Bacteria 12577
20 Ga0070695_100014245 3300005545 Bacteria 4792
21 Ga0070696_100484999 3300005546 Bacteria 981
22 Ga0070696_100751792 3300005546 Unclassified 799
23 Ga0070693_100589270 3300005547 Bacteria 801
24 Ga0068855_100010390 3300005563 Bacteria 11229
25 Ga0068855_100044475 3300005563 Bacteria 5254
26 Ga0070664_100231787 3300005564 Bacteria 1655
27 Ga0068854_100309346 3300005578 Bacteria 1281
28 Ga0068856_100022137 3300005614 Bacteria 6180
29 Ga0068852_100019161 3300005616 Bacteria 5409
30 Ga0068852_100567092 3300005616 Bacteria 1137
31 Ga0068859_100561242 3300005617 Unclassified 1236
32 Ga0070716_100437722 3300006173 Bacteria 950
33 Ga0097621_100520900 3300006237 Bacteria 1079
34 Ga0075430_100017831 3300006846 Bacteria 6043
35 Ga0075431_100185599 3300006847 Bacteria 2132
36 Ga0075434_100157686 3300006871 Bacteria 2289
37 Ga0075434_100292060 3300006871 Bacteria 1650
38 Ga0075429_100483626 3300006880 Bacteria 1085
39 Ga0097620_100561295 3300006931 Unclassified 1236
40 Ga0105240_10000001 3300009093 Bacteria 2887840
41 Ga0105240_12128342 3300009093 Unclassified 582
42 Ga0105241_10039509 3300009174 Bacteria 3560
43 Ga0105241_10405817 3300009174 Bacteria 1196
44 Ga0105242_10787708 3300009176 Unclassified 940
45 Ga0105248_11281304 3300009177 Unclassified 829
46 Ga0105239_11496757 3300010375 Bacteria 780
47 Ga0157373_10029839 3300013100 Bacteria 3926
48 Ga0157371_10118685 3300013102 Unclassified 1881
49 Ga0157371_10889177 3300013102 Unclassified 675
50 Ga0157370_10010193 3300013104 Bacteria 9924
51 Ga0157370_10427529 3300013104 Bacteria 1218
52 Ga0157369_10000445 3300013105 Bacteria 54768
53 Ga0157374_10012321 3300013296 Bacteria 7440
54 Ga0157374_10019203 3300013296 Bacteria 6047
55 Ga0157374_10034665 3300013296 Bacteria 4613
56 Ga0163162_11559988 3300013306 Unclassified 753
57 Ga0157372_10646470 3300013307 Bacteria 1232
58 Ga0182008_10408253 3300014497 Bacteria 731
59 Ga0157376_10010601 3300014969 Bacteria 6749
60 Ga0213876_10318747 3300021384 Unclassified 826
61 Ga0213875_10015737 3300021388 Bacteria 3678
62 Ga0213875_10022340 3300021388 Unclassified 3027
63 Ga0213875_10070830 3300021388 Unclassified 1627
64 Ga0213875_10097947 3300021388 Unclassified 1368
65 Ga0213875_10100038 3300021388 Unclassified 1353
66 Ga0213875_10222486 3300021388 Bacteria 889
67 Ga0213875_10233548 3300021388 Unclassified 866
68 Ga0209233_1023180 3300025261 Bacteria 1576
69 Ga0207692_10226507 3300025898 Unclassified 1110
70 Ga0207647_10047135 3300025904 Bacteria 2682
71 Ga0207699_10022840 3300025906 Bacteria 3396
72 Ga0207699_10221358 3300025906 Unclassified 1292
73 Ga0207654_10257376 3300025911 Bacteria 1172
74 Ga0207695_10000001 3300025913 Bacteria 2888630
75 Ga0207663_10633682 3300025916 Bacteria 842
76 Ga0207660_10011755 3300025917 Bacteria 5708
77 Ga0207649_10184847 3300025920 Bacteria 1461
78 Ga0207649_10310918 3300025920 Bacteria 1155
79 Ga0207652_10478854 3300025921 Bacteria 1121
80 Ga0207690_10029220 3300025932 Bacteria 3503
81 Ga0207679_10195649 3300025945 Bacteria 1685
82 Ga0207667_10009668 3300025949 Bacteria 11342
83 Ga0207667_10052737 3300025949 Bacteria 4281
84 Ga0207667_10666652 3300025949 Bacteria 1045
85 Ga0207639_10020465 3300026041 Bacteria 4736
86 Ga0207702_10007548 3300026078 Bacteria 9272
87 Ga0207702_10559898 3300026078 Bacteria 1119
88 Ga0207683_10501202 3300026121 Bacteria 1121
89 Ga0207698_10006116 3300026142 Bacteria 7492
90 Ga0265338_10105617 3300028800 Bacteria 2282
91 Ga0265342_10288903 3300031712 Unclassified 866
92 Ga0373933_0090062 3300035724 Unclassified 1892
93 Ga0373937_1784294 3300036401 Unclassified 562
94 Ga0373925_0778569 3300037068 Bacteria 789
95 Ga0436364_0218651 3300037853 Bacteria 17792
96 Ga0436364_0390764 3300037853 Unclassified 954
97 Ga0436364_0439510 3300037853 Bacteria 3333
98 Ga0436364_0544791 3300037853 Bacteria 932
99 Ga0436364_0584226 3300037853 Bacteria 3632
100 Ga0436364_0591714 3300037853 Unclassified 700
101 Ga0436364_0685912 3300037853 Unclassified 592
102 Ga0436364_0892571 3300037853 Unclassified 3203
103 Ga0436364_0940645 3300037853 Bacteria 3811
104 Ga0436364_1083018 3300037853 Bacteria 2392
105 Ga0436364_1092177 3300037853 Unclassified 930
106 Ga0436364_1341625 3300037853 Bacteria 5103
107 Ga0436365_0667239 3300039437 Bacteria 988
108 Ga0436365_1104103 3300039437 Unclassified 981
109 Ga0436365_1825348 3300039437 Bacteria 2551
110 Ga0436362_0597361 3300039453 Unclassified 1602
111 Ga0466966_0771499 3300044684 Bacteria 580
112 Ga0466957_0300600 3300044842 Bacteria 1078
113 Ga0466967_0029116 3300045976 Bacteria 4619
114 Ga0466967_0686503 3300045976 Bacteria 1014
115 Ga0466967_1634090 3300045976 Unclassified 642
116 Ga0495587_0002961 3300046536 Bacteria 11355
117 Ga0495587_0005412 3300046536 Bacteria 8332
118 Ga0495645_0276102 3300046543 Bacteria 1107
119 Ga0495623_0129648 3300046679 Bacteria 1511
120 Ga0495674_0328104 3300047319 Bacteria 1245
121 Ga0495602_0003199 3300048088 Bacteria 16896
122 Ga0495602_0016991 3300048088 Bacteria 7300
123 Ga0496104_0000039 3300048907 Bacteria 177103
124 Ga0496115_0031518 3300048918 Bacteria 4178
125 Ga0496115_0342468 3300048918 Bacteria 1220
126 Ga0501209_208293 3300049656 Unclassified 603
127 Ga0501253_156418 3300049683 Unclassified 578
128 Ga0501225_0065739 3300049705 Unclassified 1025
129 nmdc:mga0qj67_44096_c1 3300050509 Bacteria 3513
130 nmdc:mga0n895_187187_c1 3300050512 Bacteria 2101
131 Ga0436364_0261096
132 Ga0070680_100000953
133 Ga0070661_100141084
134 Ga0070661_100160736
135 Ga0070661_100620830
136 Ga0070673_100513810
137 Ga0070659_100043484
138 Ga0070709_10023268
139 Ga0070714_100149771
140 Ga0070714_100385152
141 Ga0070713_100061238
142 Ga0070710_10191990
143 Ga0070711_100066654
144 Ga0070711_100502526
145 Ga0070678_100589455
146 Ga0070678_101215743
147 Ga0070685_10682575
148 Ga0070697_100080784
149 Ga0068853_100003168
150 Ga0070695_100014245
151 Ga0070696_100484999
152 Ga0070696_100751792
153 Ga0070693_100589270
154 Ga0068855_100010390
155 Ga0068855_100044475
156 Ga0070664_100231787
157 Ga0068854_100309346
158 Ga0068856_100022137
159 Ga0068852_100019161
160 Ga0068852_100567092
161 Ga0068859_100561242
162 Ga0070716_100437722
163 Ga0097621_100520900
164 Ga0075430_100017831
165 Ga0075431_100185599
166 Ga0075434_100157686
167 Ga0075434_100292060
168 Ga0075429_100483626
169 Ga0097620_100561295
170 Ga0105240_10000001
171 Ga0105240_12128342
172 Ga0105241_10039509
173 Ga0105241_10405817
174 Ga0105242_10787708
175 Ga0105248_11281304
176 Ga0105239_11496757
177 Ga0157373_10029839
178 Ga0157371_10118685
179 Ga0157371_10889177
180 Ga0157370_10010193
181 Ga0157370_10427529
182 Ga0157369_10000445
183 Ga0157374_10012321
184 Ga0157374_10019203
185 Ga0157374_10034665
186 Ga0163162_11559988
187 Ga0157372_10646470
188 Ga0182008_10408253
189 Ga0157376_10010601
190 Ga0213876_10318747
191 Ga0213875_10015737
192 Ga0213875_10022340
193 Ga0213875_10070830
194 Ga0213875_10097947
195 Ga0213875_10100038
196 Ga0213875_10222486
197 Ga0213875_10233548
198 Ga0209233_1023180
199 Ga0207692_10226507
200 Ga0207647_10047135
201 Ga0207699_10022840
202 Ga0207699_10221358
203 Ga0207654_10257376
204 Ga0207695_10000001
205 Ga0207663_10633682
206 Ga0207660_10011755
207 Ga0207649_10184847
208 Ga0207649_10310918
209 Ga0207652_10478854
210 Ga0207690_10029220
211 Ga0207679_10195649
212 Ga0207667_10009668
213 Ga0207667_10052737
214 Ga0207667_10666652
215 Ga0207639_10020465
216 Ga0207702_10007548
217 Ga0207702_10559898
218 Ga0207683_10501202
219 Ga0207698_10006116
220 Ga0265338_10105617
221 Ga0265342_10288903
222 Ga0373933_0090062
223 Ga0373937_1784294
224 Ga0373925_0778569
225 Ga0436364_0218651
226 Ga0436364_0390764
227 Ga0436364_0439510
228 Ga0436364_0544791
229 Ga0436364_0584226
230 Ga0436364_0591714
231 Ga0436364_0685912
232 Ga0436364_0892571
233 Ga0436364_0940645
234 Ga0436364_1083018
235 Ga0436364_1092177
236 Ga0436364_1341625
237 Ga0436365_0667239
238 Ga0436365_1104103
239 Ga0436365_1825348
240 Ga0436362_0597361
241 Ga0466966_0771499
242 Ga0466957_0300600
243 Ga0466967_0029116
244 Ga0466967_0686503
245 Ga0466967_1634090
246 Ga0495587_0002961
247 Ga0495587_0005412
248 Ga0495645_0276102
249 Ga0495623_0129648
250 Ga0495674_0328104
251 Ga0495602_0003199
252 Ga0495602_0016991
253 Ga0496104_0000039
254 Ga0496115_0031518
255 Ga0496115_0342468
256 Ga0501209_208293
257 Ga0501253_156418
258 Ga0501225_0065739
259 nmdc:mga0qj67_44096_c1
260 nmdc:mga0n895_187187_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05685

Uma2

Putative restriction endonuclease

24

177

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f3s-assembly1.cif.gz_A the crystal structure of human lambda-crystallin, cryl1 0.9132 94 127
7o4u-assembly2.cif.gz_B structure of the alpha subunit of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide 0.9094 94 128
6aa8-assembly1.cif.gz_F crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with nad+ 0.8926 94 128
2pg3-assembly1.cif.gz_A-2 crystal structure of a queuosine biosynthesis protein quec (eca1155) from erwinia carotovora subsp. atroseptica scri1043 at 2.40 a resolution 0.8811 95 131
7pb1-assembly1.cif.gz_B-2 structure of the human heterotetrameric cis-prenyltransferase complex in complex with magnesium, ggpp and ispp 0.8695 94 128
ID Description Score Start End Superfamily
af_A7YT47_359_542_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8987 94 128 3.40.50.720
1zejA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8984 95 129 3.40.50.720
4kuhA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8942 94 128 3.40.50.720
4b3jB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.892 93 128 3.40.50.720
3mogC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8736 94 129 3.40.50.720
ID Description Score Start End GO Terms
AF-Q027B0-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9749 1 162
AF-A0A7V0UIV8-F1-model_v4 Uma2 family endonuclease 0.9714 1 162 GO:0004519
AF-A0A2V8V446-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9672 94 162
AF-A0A239H975-F1-model_v4 Endonuclease, Uma2 family (Restriction endonuclease fold) 0.9665 1 162 GO:0004519
AF-A0A2V8USR9-F1-model_v4 Uma2 family endonuclease 0.963 1 162 GO:0004519

Map