F143721

General Info

Members Datasets Scaffolds Average Seq Length
130 87 130 151

Family's Representative Sequence

Representative Sequence 3300001915|JGI24741J21665_1000653|JGI24741J21665_100065310
Length 165
Sequence MDNQPAPLTNQNGEQPDPPALDSAGFSTAPYVKRAEKPWGYELHWVQEDAPYMGKLLHINEGARLSLQVHDQKQESWFIIKGRGAVIWNDAAGNMVETELQPGVGYSTKVGQKHRLKGITDCDIIEVSTPEAGTTWRLEDDYARKHQTPEERADEYAKNAHIETQ

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
55 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
58 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
59 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
60 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
61 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
62 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
63 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
65 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
66 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
67 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
68 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
69 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
70 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
71 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
72 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
73 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
74 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
75 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
76 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
77 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
78 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
79 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
80 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
81 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
82 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
83 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
84 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
85 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
86 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
87 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 44.62
Nodule 0
Rhizoplane 0.77
Rhizosphere 50.77
Stem 0
Stem Tuber 0
Unclassified 3.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000653 3300001915 Bacteria 10485
2 JGI24740J21852_10018820 3300001979 Bacteria 2442
3 JGI24737J22298_10000142 3300001990 Bacteria 22268
4 JGI24735J21928_10000025 3300002067 Bacteria 88931
5 rootH2_10294691 3300003320 Bacteria 4352
6 rootL2_10190440 3300003322 Bacteria 9397
7 rootH1_10265506 3300003323 Bacteria 1505
8 rootH1_10371791 3300003323 Bacteria 1083
9 Ga0070658_10008037 3300005327 Bacteria 8482
10 Ga0070663_100465467 3300005455 Bacteria 1044
11 Ga0070678_100129430 3300005456 Bacteria 2003
12 Ga0070681_10005783 3300005458 Bacteria 11962
13 Ga0068867_100010888 3300005459 Bacteria 6415
14 Ga0070685_10234504 3300005466 Bacteria 1208
15 Ga0070665_100301059 3300005548 Bacteria 1606
16 Ga0068855_100768818 3300005563 Unclassified 1026
17 Ga0068857_100789413 3300005577 Bacteria 906
18 Ga0068856_100000002 3300005614 Bacteria 372816
19 Ga0068856_100454138 3300005614 Bacteria 1302
20 Ga0068856_102047014 3300005614 Unclassified 583
21 Ga0068860_100587612 3300005843 Bacteria 1118
22 Ga0068860_101427675 3300005843 Unclassified 713
23 Ga0075365_10000007 3300006038 Bacteria 116889
24 Ga0075365_10069470 3300006038 Bacteria 2367
25 Ga0075365_10117644 3300006038 Bacteria 1831
26 Ga0075365_11145671 3300006038 Bacteria 547
27 Ga0075363_100729908 3300006048 Unclassified 599
28 Ga0075364_10030172 3300006051 Unclassified 3479
29 Ga0075364_10163489 3300006051 Bacteria 1503
30 Ga0075364_10372281 3300006051 Unclassified 974
31 Ga0075362_10000354 3300006177 Bacteria 13173
32 Ga0075362_10038493 3300006177 Bacteria 2101
33 Ga0075362_10194319 3300006177 Unclassified 986
34 Ga0075369_10000004 3300006186 Bacteria 154675
35 Ga0075366_10000003 3300006195 Bacteria 114017
36 Ga0075366_10000108 3300006195 Bacteria 33670
37 Ga0075366_10000137 3300006195 Bacteria 30735
38 Ga0075366_10000809 3300006195 Bacteria 14998
39 Ga0075370_10068190 3300006353 Unclassified 2031
40 Ga0075370_10084675 3300006353 Bacteria 1825
41 Ga0068871_100216712 3300006358 Unclassified 1657
42 Ga0068865_100019109 3300006881 Unclassified 4432
43 Ga0105240_10000003 3300009093 Bacteria 1183681
44 Ga0105245_10000001 3300009098 Bacteria 939270
45 Ga0105245_10000618 3300009098 Bacteria 32225
46 Ga0105245_10006760 3300009098 Bacteria 10058
47 Ga0105243_10000001 3300009148 Bacteria 1156578
48 Ga0105243_12648032 3300009148 Unclassified 541
49 Ga0105242_10000001 3300009176 Bacteria 574039
50 Ga0105237_10126325 3300009545 Unclassified 2552
51 Ga0105238_10527133 3300009551 Bacteria 1184
52 Ga0105028_104711 3300009993 Bacteria 1421
53 Ga0105239_10030796 3300010375 Bacteria 5901
54 Ga0105239_10187958 3300010375 Bacteria 2312
55 Ga0157374_10125293 3300013296 Bacteria 2483
56 Ga0157374_10149012 3300013296 Unclassified 2274
57 Ga0163162_10454950 3300013306 Unclassified 1412
58 Ga0157376_10000001 3300014969 Bacteria 842910
59 Ga0207707_10010143 3300025912 Bacteria 8175
60 Ga0207695_10000005 3300025913 Bacteria 1196715
61 Ga0207671_10120300 3300025914 Unclassified 2007
62 Ga0207694_10380827 3300025924 Bacteria 1171
63 Ga0207687_10000001 3300025927 Bacteria 1130810
64 Ga0207687_10000004 3300025927 Bacteria 841177
65 Ga0207687_10000857 3300025927 Bacteria 20568
66 Ga0207686_10000001 3300025934 Bacteria 1169580
67 Ga0207709_10000002 3300025935 Bacteria 1171536
68 Ga0207704_10019406 3300025938 Unclassified 3570
69 Ga0207667_10266312 3300025949 Bacteria 1752
70 Ga0207678_10086109 3300026067 Unclassified 2685
71 Ga0207702_10000001 3300026078 Bacteria 895738
72 Ga0207702_10009430 3300026078 Bacteria 8198
73 Ga0207702_11139917 3300026078 Unclassified 774
74 Ga0207702_11711433 3300026078 Unclassified 622
75 Ga0207648_10027379 3300026089 Bacteria 5060
76 Ga0207674_10656689 3300026116 Bacteria 1013
77 Ga0268264_11082426 3300028381 Unclassified 810
78 Ga0395900_0185193 3300037418 Bacteria 2114
79 Ga0395900_1722636 3300037418 Unclassified 537
80 Ga0451807_0378891 3300041486 Bacteria 1157
81 Ga0450916_056920 3300042530 Unclassified 628
82 Ga0466967_0819384 3300045976 Unclassified 924
83 Ga0495609_0217818 3300046538 Bacteria 793
84 Ga0495622_0000008 3300046557 Bacteria 232461
85 Ga0495588_0000322 3300046674 Bacteria 31828
86 Ga0495658_0002805 3300046683 Bacteria 8754
87 Ga0495593_0079619 3300047673 Bacteria 1696
88 Ga0496126_0021535 3300048929 Bacteria 6295
89 Ga0501034_0271653 3300049571 Bacteria 1636
90 Ga0501083_0021824 3300049744 Bacteria 4447
91 nmdc:mga03683_1461_c2 3300050489 Bacteria 2761
92 nmdc:mga03683_236448_c1 3300050489 Bacteria 846
93 nmdc:mga03683_43_c1 3300050489 Bacteria 16741
94 nmdc:mga03683_58271_c1 3300050489 Unclassified 1006
95 nmdc:mga00v17_108620_c1 3300050491 Bacteria 1758
96 nmdc:mga00v17_24826_c1 3300050491 Unclassified 3479
97 nmdc:mga00v17_488233_c1 3300050491 Unclassified 799
98 nmdc:mga00v17_8274_c1 3300050491 Bacteria 5200
99 nmdc:mga0yw44_1171098_c1 3300050492 Unclassified 519
100 nmdc:mga0yw44_273807_c1 3300050492 Unclassified 1127
101 nmdc:mga0yw44_7_c1 3300050492 Bacteria 260877
102 nmdc:mga0yw44_80553_c1 3300050492 Bacteria 2040
103 nmdc:mga0yw44_82660_c1 3300050492 Bacteria 2015
104 nmdc:mga0k408_15_c1 3300050493 Bacteria 124193
105 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
106 nmdc:mga0k408_56_c1 3300050493 Bacteria 57024
107 nmdc:mga0k408_59_c1 3300050493 Bacteria 39640
108 nmdc:mga07m45_31159_c1 3300050496 Unclassified 2954
109 nmdc:mga0sz30_10_c3 3300050516 Bacteria 40799
110 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
111 Ga0500643_000061 3300053087 Bacteria 127538
112 Ga0500643_160022 3300053087 Unclassified 604
113 Ga0500644_0067639 3300053088 Unclassified 1278
114 Ga0500583_0009025 3300053092 Bacteria 3619
115 Ga0500583_0031756 3300053092 Bacteria 2325
116 Ga0500566_0000001 3300053094 Bacteria 1101031
117 Ga0500650_0015800 3300053098 Bacteria 3225
118 Ga0500562_000002 3300053108 Bacteria 977234
119 Ga0500594_0000021 3300053118 Bacteria 54302
120 Ga0500614_000001 3300053123 Bacteria 1274484
121 Ga0500614_001851 3300053123 Bacteria 4888
122 Ga0500628_000005 3300053129 Bacteria 201423
123 Ga0500559_0233534 3300053136 Unclassified 867
124 Ga0500561_0000002 3300053137 Bacteria 394147
125 Ga0500574_065250 3300053141 Bacteria 1062
126 Ga0500589_041375 3300053147 Bacteria 2150
127 Ga0500604_0004539 3300053151 Unclassified 3681
128 Ga0500616_0000005 3300053153 Bacteria 961725
129 Ga0500649_000006 3300053722 Bacteria 116211
130 Ga0500611_001595 3300053727 Bacteria 2539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050492 nmdc:mga0yw44_1171098_c1 nmdc:mga0yw44_1171098_c1_81_497 137
2 3300005458 Ga0070681_10005783 Ga0070681_1000578310 145
3 3300006038 Ga0075365_11145671 Ga0075365_111456712 145
4 3300006186 Ga0075369_10000004 Ga0075369_1000000443 145
5 3300025912 Ga0207707_10010143 Ga0207707_100101436 145
6 3300050489 nmdc:mga03683_236448_c1 nmdc:mga03683_236448_c1_374_811 145
7 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_183943_184380 145
8 3300053098 Ga0500650_0015800 Ga0500650_0015800_2427_2864 145
9 3300053153 Ga0500616_0000005 Ga0500616_0000005_853509_853946 145
10 3300005466 Ga0070685_10234504 Ga0070685_102345041 146
11 3300005548 Ga0070665_100301059 Ga0070665_1003010592 146
12 3300009098 Ga0105245_10000001 Ga0105245_10000001865 146
13 3300009098 Ga0105245_10006760 Ga0105245_100067606 146
14 3300010375 Ga0105239_10187958 Ga0105239_101879582 146
15 3300013296 Ga0157374_10125293 Ga0157374_101252934 146
16 3300013296 Ga0157374_10149012 Ga0157374_101490122 146
17 3300014969 Ga0157376_10000001 Ga0157376_10000001782 146
18 3300025927 Ga0207687_10000001 Ga0207687_10000001426 146
19 3300025927 Ga0207687_10000004 Ga0207687_10000004406 146
20 3300037418 Ga0395900_0185193 Ga0395900_0185193_1085_1525 146
21 3300049571 Ga0501034_0271653 Ga0501034_0271653_329_769 146
22 3300005455 Ga0070663_100465467 Ga0070663_1004654672 147
23 3300005459 Ga0068867_100010888 Ga0068867_1000108884 147
24 3300005614 Ga0068856_100000002 Ga0068856_100000002272 147
25 3300005614 Ga0068856_100454138 Ga0068856_1004541382 147
26 3300005614 Ga0068856_102047014 Ga0068856_1020470142 147
27 3300005843 Ga0068860_100587612 Ga0068860_1005876122 147
28 3300006358 Ga0068871_100216712 Ga0068871_1002167122 147
29 3300006881 Ga0068865_100019109 Ga0068865_1000191092 147
30 3300009093 Ga0105240_10000003 Ga0105240_10000003125 147
31 3300009098 Ga0105245_10000618 Ga0105245_1000061827 147
32 3300009148 Ga0105243_10000001 Ga0105243_100000011125 147
33 3300009148 Ga0105243_12648032 Ga0105243_126480321 147
34 3300009176 Ga0105242_10000001 Ga0105242_10000001133 147
35 3300009545 Ga0105237_10126325 Ga0105237_101263253 147
36 3300010375 Ga0105239_10030796 Ga0105239_100307963 147
37 3300013306 Ga0163162_10454950 Ga0163162_104549502 147
38 3300025913 Ga0207695_10000005 Ga0207695_10000005132 147
39 3300025914 Ga0207671_10120300 Ga0207671_101203002 147
40 3300025927 Ga0207687_10000857 Ga0207687_1000085713 147
41 3300025934 Ga0207686_10000001 Ga0207686_1000000115 147
42 3300025935 Ga0207709_10000002 Ga0207709_10000002132 147
43 3300025938 Ga0207704_10019406 Ga0207704_100194063 147
44 3300026067 Ga0207678_10086109 Ga0207678_100861093 147
45 3300026078 Ga0207702_10000001 Ga0207702_10000001160 147
46 3300026078 Ga0207702_10009430 Ga0207702_100094309 147
47 3300026078 Ga0207702_11139917 Ga0207702_111399172 147
48 3300026078 Ga0207702_11711433 Ga0207702_117114331 147
49 3300026089 Ga0207648_10027379 Ga0207648_100273793 147
50 3300045976 Ga0466967_0819384 Ga0466967_0819384_470_913 147
51 3300048929 Ga0496126_0021535 Ga0496126_0021535_224_667 147
52 3300053087 Ga0500643_160022 Ga0500643_160022_128_571 147
53 3300053088 Ga0500644_0067639 Ga0500644_0067639_361_804 147
54 3300053092 Ga0500583_0031756 Ga0500583_0031756_76_519 147
55 3300053727 Ga0500611_001595 Ga0500611_001595_1275_1718 147
56 3300049744 Ga0501083_0021824 Ga0501083_0021824_495_941 148
57 3300005327 Ga0070658_10008037 Ga0070658_1000803710 149
58 3300005577 Ga0068857_100789413 Ga0068857_1007894132 149
59 3300006048 Ga0075363_100729908 Ga0075363_1007299082 149
60 3300009551 Ga0105238_10527133 Ga0105238_105271332 149
61 3300025924 Ga0207694_10380827 Ga0207694_103808272 149
62 3300026116 Ga0207674_10656689 Ga0207674_106566892 149
63 3300005563 Ga0068855_100768818 Ga0068855_1007688182 150
64 3300006038 Ga0075365_10000007 Ga0075365_10000007118 150
65 3300025949 Ga0207667_10266312 Ga0207667_102663124 150
66 3300046538 Ga0495609_0217818 Ga0495609_0217818_218_670 150
67 3300050492 nmdc:mga0yw44_7_c1 nmdc:mga0yw44_7_c1_150340_150795 150
68 3300053087 Ga0500643_000061 Ga0500643_000061_13882_14334 150
69 3300053092 Ga0500583_0009025 Ga0500583_0009025_2359_2811 150
70 3300053147 Ga0500589_041375 Ga0500589_041375_869_1321 150
71 3300001990 JGI24737J22298_10000142 JGI24737J22298_1000014222 151
72 3300002067 JGI24735J21928_10000025 JGI24735J21928_100000257 151
73 3300003320 rootH2_10294691 rootH2_102946916 151
74 3300003322 rootL2_10190440 rootL2_101904404 151
75 3300006177 Ga0075362_10000354 Ga0075362_100003545 151
76 3300006353 Ga0075370_10068190 Ga0075370_100681902 151
77 3300042530 Ga0450916_056920 Ga0450916_056920_24_482 151
78 3300046674 Ga0495588_0000322 Ga0495588_0000322_18115_18573 151
79 3300050489 nmdc:mga03683_43_c1 nmdc:mga03683_43_c1_3366_3824 151
80 3300050496 nmdc:mga07m45_31159_c1 nmdc:mga07m45_31159_c1_1870_2328 151
81 3300053137 Ga0500561_0000002 Ga0500561_0000002_272700_273155 151
82 3300053722 Ga0500649_000006 Ga0500649_000006_30872_31330 151
83 3300006038 Ga0075365_10069470 Ga0075365_100694702 152
84 3300006038 Ga0075365_10117644 Ga0075365_101176442 152
85 3300006051 Ga0075364_10030172 Ga0075364_100301722 152
86 3300006051 Ga0075364_10372281 Ga0075364_103722812 152
87 3300006177 Ga0075362_10038493 Ga0075362_100384933 152
88 3300006177 Ga0075362_10194319 Ga0075362_101943192 152
89 3300006195 Ga0075366_10000108 Ga0075366_100001086 152
90 3300006195 Ga0075366_10000137 Ga0075366_1000013728 152
91 3300006195 Ga0075366_10000809 Ga0075366_100008098 152
92 3300046557 Ga0495622_0000008 Ga0495622_0000008_218854_219315 152
93 3300046683 Ga0495658_0002805 Ga0495658_0002805_6808_7269 152
94 3300047673 Ga0495593_0079619 Ga0495593_0079619_44_505 152
95 3300050489 nmdc:mga03683_1461_c2 nmdc:mga03683_1461_c2_2198_2659 152
96 3300050491 nmdc:mga00v17_24826_c1 nmdc:mga00v17_24826_c1_627_1088 152
97 3300050491 nmdc:mga00v17_8274_c1 nmdc:mga00v17_8274_c1_3026_3484 152
98 3300050492 nmdc:mga0yw44_273807_c1 nmdc:mga0yw44_273807_c1_21_482 152
99 3300050492 nmdc:mga0yw44_80553_c1 nmdc:mga0yw44_80553_c1_295_753 152
100 3300050492 nmdc:mga0yw44_82660_c1 nmdc:mga0yw44_82660_c1_606_1067 152
101 3300050493 nmdc:mga0k408_56_c1 nmdc:mga0k408_56_c1_52348_52806 152
102 3300050493 nmdc:mga0k408_59_c1 nmdc:mga0k408_59_c1_13404_13865 152
103 3300053094 Ga0500566_0000001 Ga0500566_0000001_73946_74407 152
104 3300053123 Ga0500614_001851 Ga0500614_001851_4383_4844 152
105 3300053136 Ga0500559_0233534 Ga0500559_0233534_104_565 152
106 3300053141 Ga0500574_065250 Ga0500574_065250_63_524 152
107 3300003323 rootH1_10265506 rootH1_102655062 153
108 3300006051 Ga0075364_10163489 Ga0075364_101634891 153
109 3300006195 Ga0075366_10000003 Ga0075366_100000037 153
110 3300006353 Ga0075370_10084675 Ga0075370_100846752 153
111 3300009993 Ga0105028_104711 Ga0105028_1047112 153
112 3300037418 Ga0395900_1722636 Ga0395900_1722636_47_508 153
113 3300050491 nmdc:mga00v17_488233_c1 nmdc:mga00v17_488233_c1_241_708 153
114 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_110700_111164 153
115 3300050516 nmdc:mga0sz30_10_c3 nmdc:mga0sz30_10_c3_39467_39931 153
116 3300053108 Ga0500562_000002 Ga0500562_000002_359884_360345 153
117 3300053123 Ga0500614_000001 Ga0500614_000001_937544_938008 153
118 3300053151 Ga0500604_0004539 Ga0500604_0004539_2891_3355 153
119 3300041486 Ga0451807_0378891 Ga0451807_0378891_331_795 154
120 3300005843 Ga0068860_101427675 Ga0068860_1014276752 156
121 3300028381 Ga0268264_11082426 Ga0268264_110824261 156
122 3300050491 nmdc:mga00v17_108620_c1 nmdc:mga00v17_108620_c1_1194_1682 159
123 3300050489 nmdc:mga03683_58271_c1 nmdc:mga03683_58271_c1_23_508 161
124 3300050493 nmdc:mga0k408_15_c1 nmdc:mga0k408_15_c1_47681_48166 161
125 3300053118 Ga0500594_0000021 Ga0500594_0000021_5143_5634 162
126 3300053129 Ga0500628_000005 Ga0500628_000005_168543_169031 162
127 3300003323 rootH1_10371791 rootH1_103717912 164
128 3300001915 JGI24741J21665_1000653 JGI24741J21665_100065310 165
129 3300001979 JGI24740J21852_10018820 JGI24740J21852_100188203 165
130 3300005456 Ga0070678_100129430 Ga0070678_1001294302 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01050

MannoseP_isomer

Mannose-6-phosphate isomerase C-terminal

27

147

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2phd-assembly1.cif.gz_C crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.9087 54 128
2phd-assembly1.cif.gz_A crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.9053 54 128
3ww3-assembly1.cif.gz_A-2 x-ray structures of cellulomonas parahominis l-ribose isomerase with no ligand 0.8825 54 131
3ww3-assembly1.cif.gz_B-2 x-ray structures of cellulomonas parahominis l-ribose isomerase with no ligand 0.8825 54 130
3ww2-assembly1.cif.gz_A x-ray structures of cellulomonas parahominis l-ribose isomerase with l-psicose 0.8808 54 130
ID Description Score Start End Superfamily
2vqaB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8858 54 130 2.60.120.10
af_Q9S772_37_227_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8774 54 138 2.60.120.10
af_Q8BK58_23_283_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8663 53 130 2.60.120.650
1ud1A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8607 54 138 2.60.120.10
2vqaC01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8557 54 138 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A554KXS6-F1-model_v4 Cupin domain-containing protein 0.9506 27 148 GO:0005976
GO:0016779
AF-A0A1F6BGW0-F1-model_v4 Mannose-6-phosphate isomerase type II C-terminal domain-containing protein 0.9421 26 150 GO:0005976
GO:0016779
AF-A0A2M7BBP6-F1-model_v4 Cupin 0.9359 30 157
AF-A0A554KXS6-F1-model_v4 Cupin domain-containing protein 0.9357 27 148 GO:0005976
GO:0016779
AF-A0A2M8GJ99-F1-model_v4 Cupin 0.9337 32 152 GO:0005976
GO:0016779

Feature Viewer

pLDDT pTM Quality
89.08 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map