F140654

General Info

Members Datasets Scaffolds Average Seq Length
129 102 258 154

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100004231|Ga0070660_1000042312
Length 158
Sequence MASGAQLDDRGIVLTCPSCGQRNRIVYERLADAVRCGKCKTTLTAPAAPLEIRHSAEFDRLIAKASIPVVVDYWAPWCGPCRMVAPELEKVAARNAGRWLVVKVNTDVCTDLGERFRIQSIPTLAVFSGGREVARTSGARPAADVERFIADATQAIHR

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
39 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
54 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
55 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
56 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
57 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
60 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
61 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
62 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
67 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
68 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
69 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
70 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
73 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
81 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
82 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
83 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
84 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
87 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
92 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
93 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
94 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
95 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
96 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
97 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
98 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
99 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
100 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
102 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 3.88
Rhizosphere 91.47
Stem 0
Stem Tuber 0
Unclassified 3.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100004231 3300005339 Bacteria 9912
2 rootH1_10041886 3300003316 Bacteria 1360
3 Ga0065712_10076141 3300005290 Bacteria 3721
4 Ga0065712_10169716 3300005290 Bacteria 1242
5 Ga0070670_100134381 3300005331 Bacteria 2137
6 Ga0068869_100126211 3300005334 Bacteria 1962
7 Ga0070666_10722509 3300005335 Bacteria 731
8 Ga0070692_10957193 3300005345 Bacteria 596
9 Ga0070668_100081449 3300005347 Bacteria 2538
10 Ga0070673_100479224 3300005364 Bacteria 1123
11 Ga0070659_101193217 3300005366 Bacteria 673
12 Ga0070708_101069508 3300005445 Bacteria 756
13 Ga0070678_100429834 3300005456 Bacteria 1153
14 Ga0070681_10855570 3300005458 Bacteria 827
15 Ga0070679_100196156 3300005530 Bacteria 1986
16 Ga0070679_100430150 3300005530 Bacteria 1265
17 Ga0070665_101444128 3300005548 Bacteria 697
18 Ga0068852_100713126 3300005616 Bacteria 1014
19 Ga0068859_100170157 3300005617 Bacteria 2259
20 Ga0068862_100472674 3300005844 Bacteria 1185
21 Ga0081539_10016676 3300005985 Bacteria 5222
22 Ga0075365_10010579 3300006038 Bacteria 5381
23 Ga0075428_100023007 3300006844 Bacteria 6898
24 Ga0075430_100020480 3300006846 Bacteria 5626
25 Ga0075431_100114326 3300006847 Unclassified 2786
26 Ga0075434_100292082 3300006871 Bacteria 1650
27 Ga0075429_100711320 3300006880 Bacteria 880
28 Ga0097620_100170147 3300006931 Bacteria 2259
29 Ga0105240_10009019 3300009093 Bacteria 14166
30 Ga0105240_10114481 3300009093 Bacteria 3258
31 Ga0105240_10220390 3300009093 Bacteria 2210
32 Ga0111539_10006108 3300009094 Bacteria 15547
33 Ga0111539_10194310 3300009094 Bacteria 2367
34 Ga0111539_10907740 3300009094 Bacteria 1024
35 Ga0111539_11415507 3300009094 Bacteria 806
36 Ga0114129_10000574 3300009147 Bacteria 45251
37 Ga0105243_11404318 3300009148 Bacteria 719
38 Ga0105238_10190817 3300009551 Bacteria 2025
39 Ga0105238_10400802 3300009551 Bacteria 1365
40 Ga0157374_10063544 3300013296 Bacteria 3462
41 Ga0157374_11460857 3300013296 Bacteria 707
42 Ga0157378_10153970 3300013297 Bacteria 2144
43 Ga0157375_10472618 3300013308 Bacteria 1419
44 Ga0163163_10000028 3300014325 Bacteria 176878
45 Ga0157380_10109445 3300014326 Bacteria 2318
46 Ga0213875_10009706 3300021388 Bacteria 4858
47 Ga0209758_1009152 3300025297 Bacteria 6232
48 Ga0207688_10172796 3300025901 Bacteria 1285
49 Ga0207657_10001598 3300025919 Bacteria 24352
50 Ga0207657_10139239 3300025919 Bacteria 1983
51 Ga0207650_10104320 3300025925 Bacteria 2187
52 Ga0207700_10009336 3300025928 Bacteria 6122
53 Ga0207690_10886060 3300025932 Bacteria 740
54 Ga0207709_11014451 3300025935 Bacteria 679
55 Ga0207669_10110280 3300025937 Bacteria 1842
56 Ga0207669_10559871 3300025937 Bacteria 924
57 Ga0207689_10084024 3300025942 Bacteria 2617
58 Ga0207667_10732458 3300025949 Bacteria 989
59 Ga0207668_10098144 3300025972 Bacteria 2170
60 Ga0207708_10269564 3300026075 Bacteria 1377
61 Ga0207683_10068641 3300026121 Bacteria 3130
62 Ga0207698_10100715 3300026142 Bacteria 2394
63 Ga0268265_11392836 3300028380 Bacteria 703
64 Ga0268265_11534634 3300028380 Bacteria 670
65 Ga0373926_0088007 3300035083 Bacteria 1153
66 Ga0373943_0607393 3300035170 Bacteria 645
67 Ga0373935_0028688 3300035692 Bacteria 3440
68 Ga0373935_0733149 3300035692 Bacteria 728
69 Ga0373937_0636372 3300036401 Bacteria 1012
70 Ga0373925_0004986 3300037068 Bacteria 9969
71 Ga0373925_0007989 3300037068 Bacteria 7703
72 Ga0436364_0463386 3300037853 Bacteria 4892
73 Ga0439461_0023406 3300041410 Bacteria 1243
74 Ga0439445_0037553 3300042004 Bacteria 1278
75 Ga0439462_0044990 3300042015 Bacteria 1182
76 Ga0439434_0273701 3300042435 Bacteria 580
77 Ga0466963_0947007 3300044694 Bacteria 606
78 Ga0451576_0008088 3300045051 Bacteria 12397
79 Ga0451576_0791747 3300045051 Bacteria 996
80 Ga0451576_1037038 3300045051 Bacteria 859
81 Ga0466967_0782342 3300045976 Bacteria 947
82 Ga0495659_0213758 3300046664 Bacteria 794
83 Ga0495581_0221745 3300047315 Bacteria 1106
84 Ga0496100_0181663 3300048903 Bacteria 1522
85 Ga0496104_1170247 3300048907 Bacteria 672
86 Ga0496106_1418368 3300048909 Bacteria 536
87 Ga0496109_0568641 3300048912 Bacteria 1069
88 Ga0496111_0393991 3300048914 Bacteria 1024
89 Ga0496126_0730584 3300048929 Bacteria 766
90 Ga0501036_0100542 3300049572 Bacteria 2446
91 Ga0501039_0183884 3300049575 Bacteria 1643
92 Ga0501041_0034374 3300049577 Bacteria 3068
93 Ga0501042_0008386 3300049578 Bacteria 6815
94 Ga0501046_0062294 3300049580 Bacteria 2915
95 Ga0501048_0016444 3300049582 Bacteria 5453
96 Ga0501071_1266204 3300049587 Bacteria 570
97 Ga0501072_0095817 3300049588 Bacteria 2359
98 Ga0501072_1012584 3300049588 Bacteria 647
99 Ga0501073_0937087 3300049589 Bacteria 596
100 Ga0501074_0506425 3300049590 Bacteria 855
101 Ga0501075_0024946 3300049591 Bacteria 4390
102 Ga0501075_0540907 3300049591 Bacteria 889
103 Ga0501076_1018772 3300049592 Bacteria 682
104 Ga0501077_0768454 3300049593 Bacteria 619
105 Ga0501079_0072555 3300049741 Bacteria 2661
106 Ga0501079_0454430 3300049741 Bacteria 1006
107 Ga0501079_0867514 3300049741 Bacteria 711
108 Ga0501080_0298086 3300049742 Bacteria 1463
109 Ga0501081_0015675 3300049743 Bacteria 5003
110 Ga0501035_0512631 3300049822 Bacteria 986
111 Ga0501045_0010281 3300049824 Bacteria 6555
112 Ga0501045_0281992 3300049824 Bacteria 1237
113 nmdc:mga05p37_136229_c1 3300050507 Unclassified 3011
114 nmdc:mga05p37_1523596_c1 3300050507 Unclassified 664
115 nmdc:mga05p37_569_c2 3300050507 Bacteria 24307
116 nmdc:mga06r32_130116_c1 3300050510 Bacteria 2488
117 nmdc:mga08y16_1512298_c1 3300050511 Bacteria 631
118 nmdc:mga08y16_19263_c1 3300050511 Bacteria 7191
119 nmdc:mga0n895_2127_c1 3300050512 Bacteria 15300
120 nmdc:mga0n895_236449_c1 3300050512 Bacteria 1854
121 nmdc:mga0rr50_1078856_c1 3300050513 Unclassified 683
122 nmdc:mga0rr50_171161_c1 3300050513 Bacteria 1770
123 nmdc:mga08x19_586690_c1 3300050514 Bacteria 789
124 nmdc:mga0a205_19362_c1 3300050515 Bacteria 4766
125 nmdc:mga0a205_80380_c1 3300050515 Bacteria 3150
126 Ga0495612_0511749 3300053078 Bacteria 551
127 Ga0501084_0925652 3300054114 Bacteria 733
128 Ga0501082_0315534 3300060353 Bacteria 1362
129 Ga0530510_0034927 3300061734 Bacteria 3622
130 Ga0070660_100004231
131 rootH1_10041886
132 Ga0065712_10076141
133 Ga0065712_10169716
134 Ga0070670_100134381
135 Ga0068869_100126211
136 Ga0070666_10722509
137 Ga0070692_10957193
138 Ga0070668_100081449
139 Ga0070673_100479224
140 Ga0070659_101193217
141 Ga0070708_101069508
142 Ga0070678_100429834
143 Ga0070681_10855570
144 Ga0070679_100196156
145 Ga0070679_100430150
146 Ga0070665_101444128
147 Ga0068852_100713126
148 Ga0068859_100170157
149 Ga0068862_100472674
150 Ga0081539_10016676
151 Ga0075365_10010579
152 Ga0075428_100023007
153 Ga0075430_100020480
154 Ga0075431_100114326
155 Ga0075434_100292082
156 Ga0075429_100711320
157 Ga0097620_100170147
158 Ga0105240_10009019
159 Ga0105240_10114481
160 Ga0105240_10220390
161 Ga0111539_10006108
162 Ga0111539_10194310
163 Ga0111539_10907740
164 Ga0111539_11415507
165 Ga0114129_10000574
166 Ga0105243_11404318
167 Ga0105238_10190817
168 Ga0105238_10400802
169 Ga0157374_10063544
170 Ga0157374_11460857
171 Ga0157378_10153970
172 Ga0157375_10472618
173 Ga0163163_10000028
174 Ga0157380_10109445
175 Ga0213875_10009706
176 Ga0209758_1009152
177 Ga0207688_10172796
178 Ga0207657_10001598
179 Ga0207657_10139239
180 Ga0207650_10104320
181 Ga0207700_10009336
182 Ga0207690_10886060
183 Ga0207709_11014451
184 Ga0207669_10110280
185 Ga0207669_10559871
186 Ga0207689_10084024
187 Ga0207667_10732458
188 Ga0207668_10098144
189 Ga0207708_10269564
190 Ga0207683_10068641
191 Ga0207698_10100715
192 Ga0268265_11392836
193 Ga0268265_11534634
194 Ga0373926_0088007
195 Ga0373943_0607393
196 Ga0373935_0028688
197 Ga0373935_0733149
198 Ga0373937_0636372
199 Ga0373925_0004986
200 Ga0373925_0007989
201 Ga0436364_0463386
202 Ga0439461_0023406
203 Ga0439445_0037553
204 Ga0439462_0044990
205 Ga0439434_0273701
206 Ga0466963_0947007
207 Ga0451576_0008088
208 Ga0451576_0791747
209 Ga0451576_1037038
210 Ga0466967_0782342
211 Ga0495659_0213758
212 Ga0495581_0221745
213 Ga0496100_0181663
214 Ga0496104_1170247
215 Ga0496106_1418368
216 Ga0496109_0568641
217 Ga0496111_0393991
218 Ga0496126_0730584
219 Ga0501036_0100542
220 Ga0501039_0183884
221 Ga0501041_0034374
222 Ga0501042_0008386
223 Ga0501046_0062294
224 Ga0501048_0016444
225 Ga0501071_1266204
226 Ga0501072_0095817
227 Ga0501072_1012584
228 Ga0501073_0937087
229 Ga0501074_0506425
230 Ga0501075_0024946
231 Ga0501075_0540907
232 Ga0501076_1018772
233 Ga0501077_0768454
234 Ga0501079_0072555
235 Ga0501079_0454430
236 Ga0501079_0867514
237 Ga0501080_0298086
238 Ga0501081_0015675
239 Ga0501035_0512631
240 Ga0501045_0010281
241 Ga0501045_0281992
242 nmdc:mga05p37_136229_c1
243 nmdc:mga05p37_1523596_c1
244 nmdc:mga05p37_569_c2
245 nmdc:mga06r32_130116_c1
246 nmdc:mga08y16_1512298_c1
247 nmdc:mga08y16_19263_c1
248 nmdc:mga0n895_2127_c1
249 nmdc:mga0n895_236449_c1
250 nmdc:mga0rr50_1078856_c1
251 nmdc:mga0rr50_171161_c1
252 nmdc:mga08x19_586690_c1
253 nmdc:mga0a205_19362_c1
254 nmdc:mga0a205_80380_c1
255 Ga0495612_0511749
256 Ga0501084_0925652
257 Ga0501082_0315534
258 Ga0530510_0034927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21352

Thio2_N

Thioredoxin 2, N-terminal

15

41

0.97

PF00085

Thioredoxin

Thioredoxin

49

151

0.96

PF13098

Thioredoxin_2

Thioredoxin-like domain

62

149

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hr1-assembly7.cif.gz_G crystal structure of thioredoxin l107a mutant 0.9858 65 139
2yj7-assembly2.cif.gz_B crystal structure of a hyperstable protein from the precambrian period 0.978 41 142
4ulx-assembly1.cif.gz_A crystal structure of ancestral thioredoxin, relative to the last common ancestor of the cyanobacterial, deinococcus and thermus groups, lpbca-l89k mutant. 0.9774 41 142
3nof-assembly1.cif.gz_A mycobacterium tuberculosis thioredoxin c c40s mutant 0.9765 41 141
2yn1-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period 0.9758 41 143
ID Description Score Start End Superfamily
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9858 65 139 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9774 41 142 3.40.30.10
af_Q8LD49_56_177_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9739 39 145 3.40.30.10
3dieB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9734 69 142 3.40.30.10
af_Q9SEU7_68_173_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9619 41 144 3.40.30.10
ID Description Score Start End GO Terms
AF-I4EHK4-F1-model_v4 Thioredoxin 0.9893 41 144 GO:0005829
GO:0015035
AF-A0A7C5RHI0-F1-model_v4 Thioredoxin 0.9857 41 143 GO:0005737
GO:0015035
AF-A0A5E4JIL8-F1-model_v4 Thioredoxin 0.9856 41 142 GO:0005737
GO:0015035
AF-A0A0K8QRM6-F1-model_v4 Thioredoxin 0.9855 2 144 GO:0005737
GO:0015035
AF-A0A2A4WVU2-F1-model_v4 Thioredoxin 0.9847 41 145 GO:0005737
GO:0015035

Map