F132933

General Info

Members Datasets Scaffolds Average Seq Length
127 97 127 391

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100011250|Ga0070683_1000112505
Length 425
Sequence VASHPGNPTAFDGPAGKPQAIAWSFADGRQASGLTLPGMNRAQPRKVLIVGGGVGALEAAIALGDLAGGKARVEICAGRGEFVYRPFAVGEPYGASRVLRYDLADLAERCGAELRLDNIASVDPALRCATTHDGEEIPYDYLVVSPGTRLLWSVPGAVTFWGVADEGEMLEIVGRLREGRLRRLIFTMPGGHGWALPAYELALLAAGELSRHGIAGTEITVVTPEDGPLLIFGRRASEQVADLLADHDVNVLTGTHPVKYENGALSVVPGEPIEADAVVSLPRLEGRHIEGLPYDSSGFIPVDDHARIEGLSNAFAVGDVTNFPIKQGGIATQQADVAAEAIAADLGCDAEANPLDPVLRGVLWTGAKPRYLFGWLGGGHGETSVASERPPWPIDNPSKLIGRYLTPFLADLQASSRAEPSSAAG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
64 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
67 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
68 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
69 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
72 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
73 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
74 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
75 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
78 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
82 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
83 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
84 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
95 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
96 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
97 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.6
Rhizosphere 86.61
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100004116 3300005329 Bacteria 11913
2 Ga0070683_100011250 3300005329 Bacteria 7722
3 Ga0070683_100068686 3300005329 Bacteria 3302
4 Ga0070683_100088455 3300005329 Bacteria 2906
5 Ga0070682_100000359 3300005337 Bacteria 30882
6 Ga0068868_100002073 3300005338 Bacteria 13783
7 Ga0070691_10006007 3300005341 Bacteria 5542
8 Ga0070661_100000005 3300005344 Bacteria 220455
9 Ga0070675_100000043 3300005354 Bacteria 77565
10 Ga0070674_100000022 3300005356 Bacteria 85839
11 Ga0070659_100001299 3300005366 Bacteria 18123
12 Ga0070713_100000382 3300005436 Bacteria 28324
13 Ga0070713_100099823 3300005436 Bacteria 2512
14 Ga0070679_100002214 3300005530 Bacteria 17551
15 Ga0070684_100012445 3300005535 Bacteria 6819
16 Ga0068853_100156584 3300005539 Bacteria 2053
17 Ga0070672_100000004 3300005543 Bacteria 129970
18 Ga0070665_100000202 3300005548 Bacteria 104773
19 Ga0070664_100025717 3300005564 Bacteria 4881
20 Ga0068854_100000087 3300005578 Bacteria 65939
21 Ga0068856_100000064 3300005614 Bacteria 98907
22 Ga0068856_100005720 3300005614 Bacteria 12246
23 Ga0068856_100008835 3300005614 Bacteria 9804
24 Ga0068852_100007603 3300005616 Bacteria 7924
25 Ga0068866_10000001 3300005718 Bacteria 519680
26 Ga0068851_10000450 3300005834 Bacteria 18356
27 Ga0068858_100000012 3300005842 Bacteria 216931
28 Ga0070712_100004158 3300006175 Bacteria 8896
29 Ga0105245_10000056 3300009098 Bacteria 124109
30 Ga0105245_10001608 3300009098 Bacteria 20542
31 Ga0105238_10000023 3300009551 Bacteria 196844
32 Ga0157371_10001996 3300013102 Bacteria 20195
33 Ga0157370_10049960 3300013104 Bacteria 3999
34 Ga0157370_10108789 3300013104 Bacteria 2591
35 Ga0157369_10000099 3300013105 Bacteria 120032
36 Ga0157374_10029673 3300013296 Bacteria 4957
37 Ga0157378_10029715 3300013297 Bacteria 4826
38 Ga0157372_10000078 3300013307 Bacteria 101111
39 Ga0157375_10383624 3300013308 Bacteria 1572
40 Ga0157380_10000487 3300014326 Bacteria 24132
41 Ga0157376_10143273 3300014969 Bacteria 2146
42 Ga0206356_11055573 3300020070 Bacteria 2415
43 Ga0206353_11449945 3300020082 Bacteria 1898
44 Ga0207656_10000366 3300025321 Bacteria 15163
45 Ga0207642_10000006 3300025899 Bacteria 230268
46 Ga0207642_10000007 3300025899 Bacteria 226017
47 Ga0207707_10021113 3300025912 Bacteria 5691
48 Ga0207693_10003704 3300025915 Bacteria 13030
49 Ga0207663_10016928 3300025916 Bacteria 4053
50 Ga0207649_10000005 3300025920 Bacteria 356179
51 Ga0207652_10002532 3300025921 Bacteria 15343
52 Ga0207694_10000004 3300025924 Bacteria 967075
53 Ga0207659_10000020 3300025926 Bacteria 151552
54 Ga0207687_10000007 3300025927 Bacteria 604185
55 Ga0207687_10000055 3300025927 Bacteria 88382
56 Ga0207687_10002277 3300025927 Bacteria 13063
57 Ga0207700_10000008 3300025928 Bacteria 341717
58 Ga0207700_10106037 3300025928 Bacteria 2252
59 Ga0207664_10106478 3300025929 Bacteria 2325
60 Ga0207690_10001943 3300025932 Bacteria 12670
61 Ga0207690_10041522 3300025932 Bacteria 3015
62 Ga0207669_10000009 3300025937 Bacteria 168012
63 Ga0207691_10000020 3300025940 Bacteria 133465
64 Ga0207661_10000164 3300025944 Bacteria 43091
65 Ga0207661_10002364 3300025944 Bacteria 12980
66 Ga0207661_10044820 3300025944 Bacteria 3498
67 Ga0207661_10064232 3300025944 Bacteria 2975
68 Ga0207679_10006199 3300025945 Bacteria 7548
69 Ga0207640_10000152 3300025981 Bacteria 50232
70 Ga0207677_10000914 3300026023 Bacteria 16530
71 Ga0207703_10000310 3300026035 Bacteria 52770
72 Ga0207639_10285589 3300026041 Bacteria 1453
73 Ga0207678_10156936 3300026067 Bacteria 1943
74 Ga0207702_10000016 3300026078 Bacteria 226633
75 Ga0207702_10002069 3300026078 Bacteria 19408
76 Ga0207698_10057789 3300026142 Bacteria 3003
77 Ga0268266_10000020 3300028379 Bacteria 527065
78 Ga0307415_100000891 3300032126 Bacteria 13660
79 Ga0373937_0059758 3300036401 Bacteria 3503
80 Ga0451853_0065560 3300041512 Bacteria 2314
81 Ga0466958_0013196 3300045836 Bacteria 4699
82 Ga0466967_0000045 3300045976 Bacteria 45085
83 Ga0495592_0209627 3300046454 Bacteria 1309
84 Ga0495662_0006683 3300046476 Bacteria 5748
85 Ga0495608_0000056 3300046511 Bacteria 91026
86 Ga0495628_0013306 3300046516 Bacteria 6922
87 Ga0495628_0057964 3300046516 Bacteria 3046
88 Ga0495630_0141826 3300046517 Bacteria 1827
89 Ga0495667_0000015 3300046559 Bacteria 200377
90 Ga0495634_0000212 3300046642 Bacteria 53864
91 Ga0495588_0000294 3300046674 Bacteria 35905
92 Ga0495657_0000023 3300046675 Bacteria 145522
93 Ga0495669_0025227 3300046684 Bacteria 2592
94 Ga0495613_0000023 3300046689 Bacteria 153699
95 Ga0495649_0001534 3300046694 Bacteria 17354
96 Ga0495600_0008886 3300046809 Bacteria 6191
97 Ga0495604_0000013 3300047317 Bacteria 234578
98 Ga0495680_0000196 3300047322 Bacteria 65437
99 Ga0495680_0008002 3300047322 Bacteria 9635
100 Ga0495675_0000039 3300047444 Bacteria 91025
101 Ga0495679_006873 3300047446 Bacteria 4829
102 Ga0495593_0023434 3300047673 Bacteria 3432
103 Ga0495602_0000032 3300048088 Bacteria 141185
104 Ga0495602_0057144 3300048088 Bacteria 3426
105 Ga0496104_0000190 3300048907 Bacteria 55572
106 Ga0496105_0000197 3300048908 Bacteria 40456
107 Ga0496108_0000045 3300048911 Bacteria 137416
108 Ga0496108_0011161 3300048911 Bacteria 7298
109 Ga0496109_0000021 3300048912 Bacteria 189945
110 Ga0496109_0000032 3300048912 Bacteria 162984
111 Ga0496109_0000039 3300048912 Bacteria 145769
112 Ga0496109_0016979 3300048912 Bacteria 6372
113 Ga0496110_0000018 3300048913 Bacteria 79734
114 Ga0496111_0000015 3300048914 Bacteria 77334
115 Ga0496111_0028588 3300048914 Bacteria 3952
116 Ga0496112_0000003 3300048915 Bacteria 660147
117 Ga0496112_0044357 3300048915 Bacteria 4356
118 Ga0496112_0285740 3300048915 Bacteria 1596
119 Ga0496113_0000009 3300048916 Bacteria 88223
120 Ga0496113_0029358 3300048916 Bacteria 3970
121 Ga0501068_0075117 3300049584 Bacteria 2067
122 Ga0495601_0000045 3300053077 Bacteria 73391
123 Ga0495601_0000404 3300053077 Bacteria 22810
124 Ga0495655_0000688 3300053083 Bacteria 5415
125 Ga0495595_0000029 3300053084 Bacteria 91026
126 Ga0495619_0000029 3300053085 Bacteria 158166
127 Ga0495619_0000130 3300053085 Bacteria 55619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025921 Ga0207652_10002532 Ga0207652_1000253218 328
2 3300005341 Ga0070691_10006007 Ga0070691_100060072 346
3 3300049584 Ga0501068_0075117 Ga0501068_0075117_167_1231 349
4 3300048915 Ga0496112_0285740 Ga0496112_0285740_92_1378 362
5 3300005329 Ga0070683_100068686 Ga0070683_1000686863 364
6 3300005530 Ga0070679_100002214 Ga0070679_10000221410 364
7 3300025912 Ga0207707_10021113 Ga0207707_100211135 364
8 3300025944 Ga0207661_10044820 Ga0207661_100448203 364
9 3300047446 Ga0495679_006873 Ga0495679_006873_1387_2502 364
10 3300013308 Ga0157375_10383624 Ga0157375_103836242 371
11 3300005614 Ga0068856_100005720 Ga0068856_1000057208 372
12 3300026078 Ga0207702_10002069 Ga0207702_100020698 372
13 3300046694 Ga0495649_0001534 Ga0495649_0001534_6543_7736 373
14 3300005337 Ga0070682_100000359 Ga0070682_1000003597 374
15 3300020082 Ga0206353_11449945 Ga0206353_114499451 374
16 3300053083 Ga0495655_0000688 Ga0495655_0000688_4163_5287 374
17 3300046516 Ga0495628_0057964 Ga0495628_0057964_111_1238 375
18 3300047317 Ga0495604_0000013 Ga0495604_0000013_154792_155949 375
19 3300013102 Ga0157371_10001996 Ga0157371_100019967 376
20 3300013104 Ga0157370_10108789 Ga0157370_101087892 376
21 3300009098 Ga0105245_10000056 Ga0105245_1000005674 377
22 3300025927 Ga0207687_10000007 Ga0207687_1000000749 377
23 3300046476 Ga0495662_0006683 Ga0495662_0006683_1300_2475 377
24 3300048907 Ga0496104_0000190 Ga0496104_0000190_33576_34724 377
25 3300048908 Ga0496105_0000197 Ga0496105_0000197_8194_9342 377
26 3300005366 Ga0070659_100001299 Ga0070659_1000012996 378
27 3300025932 Ga0207690_10001943 Ga0207690_100019432 378
28 3300046454 Ga0495592_0209627 Ga0495592_0209627_66_1256 378
29 3300005436 Ga0070713_100099823 Ga0070713_1000998232 382
30 3300005548 Ga0070665_100000202 Ga0070665_100000202104 382
31 3300005842 Ga0068858_100000012 Ga0068858_10000001238 382
32 3300025928 Ga0207700_10106037 Ga0207700_101060371 382
33 3300026035 Ga0207703_10000310 Ga0207703_1000031048 382
34 3300028379 Ga0268266_10000020 Ga0268266_10000020195 382
35 3300046559 Ga0495667_0000015 Ga0495667_0000015_49443_50621 382
36 3300047322 Ga0495680_0008002 Ga0495680_0008002_7879_9057 382
37 3300048915 Ga0496112_0044357 Ga0496112_0044357_2416_3564 382
38 3300048916 Ga0496113_0000009 Ga0496113_0000009_3189_4337 382
39 3300005578 Ga0068854_100000087 Ga0068854_10000008754 383
40 3300005834 Ga0068851_10000450 Ga0068851_1000045015 383
41 3300009098 Ga0105245_10001608 Ga0105245_1000160821 383
42 3300013104 Ga0157370_10049960 Ga0157370_100499603 383
43 3300013307 Ga0157372_10000078 Ga0157372_1000007810 383
44 3300025321 Ga0207656_10000366 Ga0207656_1000036611 383
45 3300025927 Ga0207687_10002277 Ga0207687_1000227710 383
46 3300025981 Ga0207640_10000152 Ga0207640_1000015213 383
47 3300046684 Ga0495669_0025227 Ga0495669_0025227_774_1925 383
48 3300048913 Ga0496110_0000018 Ga0496110_0000018_75523_76710 383
49 3300048914 Ga0496111_0000015 Ga0496111_0000015_3009_4196 383
50 3300053085 Ga0495619_0000130 Ga0495619_0000130_44463_45614 383
51 3300005436 Ga0070713_100000382 Ga0070713_10000038217 384
52 3300005614 Ga0068856_100000064 Ga0068856_10000006446 384
53 3300020070 Ga0206356_11055573 Ga0206356_110555733 384
54 3300025928 Ga0207700_10000008 Ga0207700_10000008266 384
55 3300025929 Ga0207664_10106478 Ga0207664_101064782 384
56 3300026078 Ga0207702_10000016 Ga0207702_1000001636 384
57 3300045836 Ga0466958_0013196 Ga0466958_0013196_2061_3215 384
58 3300046642 Ga0495634_0000212 Ga0495634_0000212_35984_37150 384
59 3300046689 Ga0495613_0000023 Ga0495613_0000023_114572_115756 384
60 3300048088 Ga0495602_0000032 Ga0495602_0000032_34544_35731 384
61 3300048911 Ga0496108_0011161 Ga0496108_0011161_3976_5142 384
62 3300048912 Ga0496109_0000021 Ga0496109_0000021_80683_81849 384
63 3300053077 Ga0495601_0000404 Ga0495601_0000404_18773_19960 384
64 3300005614 Ga0068856_100008835 Ga0068856_1000088357 385
65 3300013105 Ga0157369_10000099 Ga0157369_10000099105 385
66 3300025927 Ga0207687_10000055 Ga0207687_1000005572 385
67 3300032126 Ga0307415_100000891 Ga0307415_10000089110 385
68 3300046516 Ga0495628_0013306 Ga0495628_0013306_2783_3973 385
69 3300047673 Ga0495593_0023434 Ga0495593_0023434_1575_2780 385
70 3300048912 Ga0496109_0016979 Ga0496109_0016979_1563_2750 385
71 3300053077 Ga0495601_0000045 Ga0495601_0000045_1621_2811 385
72 3300005356 Ga0070674_100000022 Ga0070674_1000000226 386
73 3300005539 Ga0068853_100156584 Ga0068853_1001565842 386
74 3300005616 Ga0068852_100007603 Ga0068852_1000076032 386
75 3300005718 Ga0068866_10000001 Ga0068866_1000000191 386
76 3300009551 Ga0105238_10000023 Ga0105238_1000002361 386
77 3300013296 Ga0157374_10029673 Ga0157374_100296735 386
78 3300014326 Ga0157380_10000487 Ga0157380_100004872 386
79 3300025899 Ga0207642_10000006 Ga0207642_1000000694 386
80 3300025899 Ga0207642_10000007 Ga0207642_10000007141 386
81 3300025916 Ga0207663_10016928 Ga0207663_100169282 386
82 3300025924 Ga0207694_10000004 Ga0207694_10000004749 386
83 3300025932 Ga0207690_10041522 Ga0207690_100415222 386
84 3300025937 Ga0207669_10000009 Ga0207669_1000000990 386
85 3300026041 Ga0207639_10285589 Ga0207639_102855892 386
86 3300026142 Ga0207698_10057789 Ga0207698_100577892 386
87 3300036401 Ga0373937_0059758 Ga0373937_0059758_379_1563 386
88 3300041512 Ga0451853_0065560 Ga0451853_0065560_821_2014 386
89 3300046517 Ga0495630_0141826 Ga0495630_0141826_504_1697 386
90 3300047322 Ga0495680_0000196 Ga0495680_0000196_55895_57088 386
91 3300048088 Ga0495602_0057144 Ga0495602_0057144_2070_3251 386
92 3300048911 Ga0496108_0000045 Ga0496108_0000045_42171_43379 386
93 3300048912 Ga0496109_0000032 Ga0496109_0000032_94047_95255 386
94 3300048916 Ga0496113_0029358 Ga0496113_0029358_2512_3723 386
95 3300005329 Ga0070683_100004116 Ga0070683_1000041167 387
96 3300005329 Ga0070683_100011250 Ga0070683_1000112505 387
97 3300005329 Ga0070683_100088455 Ga0070683_1000884552 387
98 3300005338 Ga0068868_100002073 Ga0068868_1000020732 387
99 3300005344 Ga0070661_100000005 Ga0070661_100000005144 387
100 3300005354 Ga0070675_100000043 Ga0070675_10000004338 387
101 3300005535 Ga0070684_100012445 Ga0070684_1000124455 387
102 3300005543 Ga0070672_100000004 Ga0070672_10000000429 387
103 3300005564 Ga0070664_100025717 Ga0070664_1000257174 387
104 3300006175 Ga0070712_100004158 Ga0070712_1000041584 387
105 3300013297 Ga0157378_10029715 Ga0157378_100297152 387
106 3300014969 Ga0157376_10143273 Ga0157376_101432732 387
107 3300025915 Ga0207693_10003704 Ga0207693_100037044 387
108 3300025920 Ga0207649_10000005 Ga0207649_10000005287 387
109 3300025926 Ga0207659_10000020 Ga0207659_10000020133 387
110 3300025940 Ga0207691_10000020 Ga0207691_1000002096 387
111 3300025944 Ga0207661_10000164 Ga0207661_1000016413 387
112 3300025944 Ga0207661_10002364 Ga0207661_100023642 387
113 3300025944 Ga0207661_10064232 Ga0207661_100642322 387
114 3300025945 Ga0207679_10006199 Ga0207679_100061992 387
115 3300026023 Ga0207677_10000914 Ga0207677_1000091416 387
116 3300026067 Ga0207678_10156936 Ga0207678_101569362 387
117 3300045976 Ga0466967_0000045 Ga0466967_0000045_24265_25461 387
118 3300046511 Ga0495608_0000056 Ga0495608_0000056_87958_89154 387
119 3300046674 Ga0495588_0000294 Ga0495588_0000294_6457_7623 387
120 3300046675 Ga0495657_0000023 Ga0495657_0000023_1873_3069 387
121 3300046809 Ga0495600_0008886 Ga0495600_0008886_258_1454 387
122 3300047444 Ga0495675_0000039 Ga0495675_0000039_87957_89153 387
123 3300048912 Ga0496109_0000039 Ga0496109_0000039_3066_4229 387
124 3300048914 Ga0496111_0028588 Ga0496111_0028588_2517_3680 387
125 3300048915 Ga0496112_0000003 Ga0496112_0000003_274584_275759 387
126 3300053084 Ga0495595_0000029 Ga0495595_0000029_87958_89154 387
127 3300053085 Ga0495619_0000029 Ga0495619_0000029_14525_15721 387

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

45

341

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hyw-assembly1.cif.gz_A 3-d x-ray structure of the sulfide:quinone oxidoreductase of the hyperthermophilic bacterium aquifex aeolicus in complex with decylubiquinone 0.8256 7 349
8dhk-assembly1.cif.gz_B crystal structure of human sulfide quinone oxidoreductase k207e 0.8244 7 338
6oib-assembly1.cif.gz_A crystal structure of human sulfide quinone oxidoreductase in complex with coenzyme q 0.8222 7 338
6mp5-assembly1.cif.gz_A crystal structure of native human sulfide:quinone oxidoreductase 0.8201 7 338
6oi6-assembly1.cif.gz_B crystal structure of human sulfide quinone oxidoreductase in complex with coenzyme q (sulfide soaked) 0.8169 7 338
ID Description Score Start End Superfamily
af_Q8C7K6_26_328_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9029 8 41 3.50.50.60
3ukhB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8939 81 109 3.50.50.60
af_A0A1D6LYX0_29_117_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8384 144 216 3.50.50.60
3h8lB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8304 116 243 3.50.50.60
af_O94284_27_435_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8263 7 345 1.25.10.10
ID Description Score Start End GO Terms
AF-H0E6X1-F1-model_v4 FAD-dependent pyridine nucleotide-disulfide oxidoreductase 0.937 2 375 GO:0003955
GO:0019646
AF-A0A2V2SR67-F1-model_v4 deleted 0.9356 1 382
AF-A0A5B8U5Z4-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9265 1 387 GO:0003955
GO:0019646
AF-A0A5B8U5Z4-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9196 1 387 GO:0003955
GO:0019646
AF-A0A2V2SR67-F1-model_v4 deleted 0.9193 1 382

Feature Viewer

pLDDT pTM Quality
86.9 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map