F110872

General Info

Members Datasets Scaffolds Average Seq Length
121 84 242 278

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10001047|Ga0307510_100010478
Length 330
Sequence MIPFTGTDAQMYRLYIKETCQILVLLSCTYKPDHPDKKIPDFIFIFRSGTLNNTPMPNAGIIVTSLVSYKGFSNSLFFDGYKFEVDRILINKDYKRLVTSGFLHVSWTHLFFNMFSLYIFSGLVEITLGSLKFLIIYFASLLGGNLLSLLVHKNHGDFSAVGASGAIAGVMFASVAIFPDMGIGFFLLPISIPGWIYALLYVLFSIYGIRSQKNNIGHDAHLGGALIGMILALIMNPSAFMNNYGKILIILIPTVLFIYLIINRPGTLFVDNLFYKTHHDFYSIDHRYNAERADQQQEVDRILDKINRKGMGSLTMKEKETLETYSKNIR

Samples

Sample ID Description Type Environment
1 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
36 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
37 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
38 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
50 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
53 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
54 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
55 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
58 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
59 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
60 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
61 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
62 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
63 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
64 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
65 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
66 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
67 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
68 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
70 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
71 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
72 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
73 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
74 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
75 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
76 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
77 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
78 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
79 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
80 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
81 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
82 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
83 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
84 2904467357 Chitinophaga sancti 3198 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0
Isolates 3.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.05
Nodule 0
Rhizoplane 0
Rhizosphere 69.42
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307510_10001047 3300033180 Bacteria 29363
2 rootH1_10064350 3300003316 Bacteria 3426
3 rootH1_10066224 3300003316 Bacteria 5532
4 rootH2_10001125 3300003320 Bacteria 15161
5 rootH2_10011569 3300003320 Bacteria 50785
6 rootH2_10023719 3300003320 Bacteria 3775
7 rootL2_10079938 3300003322 Bacteria 4451
8 rootL2_10087530 3300003322 Bacteria 3832
9 rootL2_10089643 3300003322 Bacteria 6183
10 rootH1_10013663 3300003323 Bacteria 5014
11 rootH1_10184151 3300003323 Bacteria 2624
12 rootH1_10349133 3300003323 Bacteria 2183
13 Ga0055531_10000102 3300003794 Bacteria 92703
14 Ga0065165_1007194 3300005262 Bacteria 5560
15 Ga0070691_10060053 3300005341 Bacteria 1827
16 Ga0070681_10181121 3300005458 Bacteria 2028
17 Ga0068853_100146546 3300005539 Bacteria 2122
18 Ga0070696_100443310 3300005546 Unclassified 1023
19 Ga0070665_100000008 3300005548 Bacteria 606341
20 Ga0068855_100032345 3300005563 Bacteria 6247
21 Ga0068855_100037991 3300005563 Bacteria 5723
22 Ga0068855_100075919 3300005563 Bacteria 3901
23 Ga0070664_100517409 3300005564 Bacteria 1101
24 Ga0068854_100019492 3300005578 Bacteria 4573
25 Ga0068852_100001717 3300005616 Bacteria 14926
26 Ga0068859_100003184 3300005617 Bacteria 16694
27 Ga0068861_100462375 3300005719 Unclassified 1139
28 Ga0068851_10026752 3300005834 Bacteria 2838
29 Ga0068860_100000029 3300005843 Bacteria 259192
30 Ga0068860_100005348 3300005843 Bacteria 13028
31 Ga0068862_100288177 3300005844 Bacteria 1507
32 Ga0097621_100004237 3300006237 Bacteria 9966
33 Ga0097621_100211036 3300006237 Bacteria 1689
34 Ga0068871_100102733 3300006358 Bacteria 2396
35 Ga0068871_100202238 3300006358 Bacteria 1715
36 Ga0097620_100003184 3300006931 Bacteria 16694
37 Ga0105240_10006701 3300009093 Bacteria 16874
38 Ga0105240_10009858 3300009093 Bacteria 13484
39 Ga0105240_10070272 3300009093 Bacteria 4332
40 Ga0105240_10114990 3300009093 Bacteria 3249
41 Ga0105237_10000171 3300009545 Bacteria 90778
42 Ga0105237_10005534 3300009545 Bacteria 14241
43 Ga0105237_10137725 3300009545 Unclassified 2435
44 Ga0105239_10000064 3300010375 Bacteria 151674
45 Ga0105239_10000609 3300010375 Bacteria 50949
46 Ga0157373_10044710 3300013100 Unclassified 3161
47 Ga0157370_10003043 3300013104 Bacteria 19879
48 Ga0157369_10013114 3300013105 Bacteria 9379
49 Ga0157374_10000009 3300013296 Bacteria 564330
50 Ga0163162_10000038 3300013306 Bacteria 138065
51 Ga0163162_10120804 3300013306 Bacteria 2724
52 Ga0157372_10000231 3300013307 Bacteria 62248
53 Ga0157372_10002784 3300013307 Bacteria 18902
54 Ga0157376_10000615 3300014969 Bacteria 23091
55 Ga0182005_1001112 3300015265 Bacteria 11232
56 Ga0209436_100622 3300025208 Bacteria 15155
57 Ga0209646_1003700 3300025246 Bacteria 2946
58 Ga0209257_1000004 3300025304 Bacteria 1678347
59 Ga0207656_10021954 3300025321 Bacteria 2556
60 Ga0207647_10005456 3300025904 Bacteria 9319
61 Ga0207707_10023853 3300025912 Bacteria 5351
62 Ga0207695_10017906 3300025913 Bacteria 8206
63 Ga0207695_10094981 3300025913 Unclassified 2987
64 Ga0207695_10130814 3300025913 Bacteria 2467
65 Ga0207695_10299293 3300025913 Unclassified 1500
66 Ga0207671_10001757 3300025914 Bacteria 24379
67 Ga0207671_10025595 3300025914 Bacteria 4431
68 Ga0207671_10030082 3300025914 Bacteria 4050
69 Ga0207667_10000100 3300025949 Bacteria 138482
70 Ga0207667_10037855 3300025949 Bacteria 5156
71 Ga0207639_10073534 3300026041 Bacteria 2680
72 Ga0207639_10440335 3300026041 Bacteria 1181
73 Ga0207698_10001532 3300026142 Bacteria 13470
74 Ga0268266_10000016 3300028379 Bacteria 629101
75 Ga0268264_10000072 3300028381 Bacteria 260791
76 Ga0268264_10007773 3300028381 Bacteria 8927
77 Ga0307517_10151887 3300028786 Unclassified 1586
78 Ga0307515_10022252 3300028794 Bacteria 11180
79 Ga0265327_10000316 3300031251 Bacteria 92271
80 Ga0265327_10000659 3300031251 Bacteria 55479
81 Ga0265327_10034148 3300031251 Bacteria 2826
82 Ga0373925_0208347 3300037068 Bacteria 1557
83 Ga0439439_0035494 3300041406 Bacteria 1281
84 Ga0466972_0000007 3300044658 Bacteria 277010
85 Ga0466972_0006949 3300044658 Bacteria 5674
86 Ga0466982_0045488 3300044672 Unclassified 2673
87 Ga0466957_0001726 3300044842 Bacteria 11508
88 Ga0466957_0038255 3300044842 Bacteria 2890
89 Ga0466960_0367004 3300044901 Bacteria 824
90 Ga0466959_0005494 3300045049 Bacteria 8690
91 Ga0466958_0008086 3300045836 Bacteria 5819
92 Ga0495627_001156 3300046453 Bacteria 16999
93 Ga0495648_0000348 3300046524 Bacteria 50841
94 Ga0495633_0000017 3300046558 Bacteria 249973
95 Ga0495668_0003282 3300046616 Bacteria 12287
96 Ga0495611_0000009 3300046648 Bacteria 160002
97 Ga0495687_000004 3300047443 Bacteria 779298
98 Ga0495686_0000373 3300047472 Bacteria 71977
99 Ga0495686_0021091 3300047472 Bacteria 4334
100 Ga0496121_0000010 3300048924 Bacteria 793488
101 Ga0501047_0389386 3300049581 Bacteria 1227
102 Ga0501202_037777 3300049652 Bacteria 1033
103 Ga0501225_0037878 3300049705 Unclassified 1329
104 Ga0501044_0011376 3300049823 Bacteria 9637
105 nmdc:mga0k408_235472_c1 3300050493 Bacteria 1093
106 nmdc:mga0k408_79207_c1 3300050493 Bacteria 1922
107 Ga0500578_0000457 3300053086 Bacteria 49613
108 Ga0500646_0033506 3300053090 Bacteria 1421
109 Ga0500583_0000927 3300053092 Bacteria 8373
110 Ga0500583_0025264 3300053092 Bacteria 2534
111 Ga0500651_0066391 3300053093 Unclassified 2247
112 Ga0500568_0000699 3300053139 Bacteria 24055
113 Ga0500622_0000059 3300053156 Bacteria 134223
114 Ga0500622_0005583 3300053156 Bacteria 7504
115 Ga0500622_0111911 3300053156 Bacteria 1333
116 Ga0500611_000023 3300053727 Bacteria 102347
117 Ga0500661_001643 3300055283 Bacteria 4209
118 2819572150 2818991442 Bacteria 8318214
119 2821141607 2821136567 Bacteria 8080116
120 2881955578 2881955468 Bacteria 3545609
121 2904469979 2904467357 Bacteria 8057758
122 Ga0307510_10001047
123 rootH1_10064350
124 rootH1_10066224
125 rootH2_10001125
126 rootH2_10011569
127 rootH2_10023719
128 rootL2_10079938
129 rootL2_10087530
130 rootL2_10089643
131 rootH1_10013663
132 rootH1_10184151
133 rootH1_10349133
134 Ga0055531_10000102
135 Ga0065165_1007194
136 Ga0070691_10060053
137 Ga0070681_10181121
138 Ga0068853_100146546
139 Ga0070696_100443310
140 Ga0070665_100000008
141 Ga0068855_100032345
142 Ga0068855_100037991
143 Ga0068855_100075919
144 Ga0070664_100517409
145 Ga0068854_100019492
146 Ga0068852_100001717
147 Ga0068859_100003184
148 Ga0068861_100462375
149 Ga0068851_10026752
150 Ga0068860_100000029
151 Ga0068860_100005348
152 Ga0068862_100288177
153 Ga0097621_100004237
154 Ga0097621_100211036
155 Ga0068871_100102733
156 Ga0068871_100202238
157 Ga0097620_100003184
158 Ga0105240_10006701
159 Ga0105240_10009858
160 Ga0105240_10070272
161 Ga0105240_10114990
162 Ga0105237_10000171
163 Ga0105237_10005534
164 Ga0105237_10137725
165 Ga0105239_10000064
166 Ga0105239_10000609
167 Ga0157373_10044710
168 Ga0157370_10003043
169 Ga0157369_10013114
170 Ga0157374_10000009
171 Ga0163162_10000038
172 Ga0163162_10120804
173 Ga0157372_10000231
174 Ga0157372_10002784
175 Ga0157376_10000615
176 Ga0182005_1001112
177 Ga0209436_100622
178 Ga0209646_1003700
179 Ga0209257_1000004
180 Ga0207656_10021954
181 Ga0207647_10005456
182 Ga0207707_10023853
183 Ga0207695_10017906
184 Ga0207695_10094981
185 Ga0207695_10130814
186 Ga0207695_10299293
187 Ga0207671_10001757
188 Ga0207671_10025595
189 Ga0207671_10030082
190 Ga0207667_10000100
191 Ga0207667_10037855
192 Ga0207639_10073534
193 Ga0207639_10440335
194 Ga0207698_10001532
195 Ga0268266_10000016
196 Ga0268264_10000072
197 Ga0268264_10007773
198 Ga0307517_10151887
199 Ga0307515_10022252
200 Ga0265327_10000316
201 Ga0265327_10000659
202 Ga0265327_10034148
203 Ga0373925_0208347
204 Ga0439439_0035494
205 Ga0466972_0000007
206 Ga0466972_0006949
207 Ga0466982_0045488
208 Ga0466957_0001726
209 Ga0466957_0038255
210 Ga0466960_0367004
211 Ga0466959_0005494
212 Ga0466958_0008086
213 Ga0495627_001156
214 Ga0495648_0000348
215 Ga0495633_0000017
216 Ga0495668_0003282
217 Ga0495611_0000009
218 Ga0495687_000004
219 Ga0495686_0000373
220 Ga0495686_0021091
221 Ga0496121_0000010
222 Ga0501047_0389386
223 Ga0501202_037777
224 Ga0501225_0037878
225 Ga0501044_0011376
226 nmdc:mga0k408_235472_c1
227 nmdc:mga0k408_79207_c1
228 Ga0500578_0000457
229 Ga0500646_0033506
230 Ga0500583_0000927
231 Ga0500583_0025264
232 Ga0500651_0066391
233 Ga0500568_0000699
234 Ga0500622_0000059
235 Ga0500622_0005583
236 Ga0500622_0111911
237 Ga0500611_000023
238 Ga0500661_001643
239 2819572150
240 2821141607
241 2881955578
242 2904469979

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20216

DUF6576

Family of unknown function (DUF6576)

282

328

0.98

PF01694

Rhomboid

Rhomboid family

91

238

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pja-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.772 7 188
6pjr-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7695 6 188
6pj5-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7692 6 188
6pj8-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7659 7 188
3zot-assembly1.cif.gz_A structure of e.coli rhomboid protease glpg in complex with monobactam l29 (data set 2) 0.7648 6 187
ID Description Score Start End Superfamily
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8932 4 183 1.20.1540.10
af_Q8I3V7_262_478_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8887 2 180 1.20.1540.10
af_I1JZG9_137_329_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8543 7 178 1.20.1540.10
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8496 4 183 1.20.1540.10
af_O14364_73_276_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8476 3 180 1.20.1540.10
ID Description Score Start End GO Terms
AF-A0A848TZY9-F1-model_v4 Rhomboid family intramembrane serine protease 0.9823 7 120 GO:0004252
GO:0006508
GO:0016020
AF-A0A352SML9-F1-model_v4 Rhomboid family intramembrane serine protease 0.9565 7 131 GO:0004252
GO:0006508
GO:0016020
AF-A0A4Q3HFM0-F1-model_v4 deleted 0.9554 7 127
AF-A0A2T2SJT5-F1-model_v4 Rhomboid family intramembrane serine protease 0.946 2 142 GO:0004252
GO:0006508
GO:0016020
AF-A0A7C5G9Z9-F1-model_v4 Rhomboid family intramembrane serine protease 0.9423 6 150 GO:0004252
GO:0006508
GO:0016020

Map