F094784

General Info

Members Datasets Scaffolds Average Seq Length
117 85 117 95

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0940292|Ga0501075_0940292_309_638
Length 109
Sequence MRRIANTASRRAAQRPRKAGGGSRELEVLERVREIPAGFVRTYGDVSPGAPRFAGSVLFECDDPDLPWWRVVRADGSLAKGAAQRRLLRAEGVPFRGDRVDMDAARLPA

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
13 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
14 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
28 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
46 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
47 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
48 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
49 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
50 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
51 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
52 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
53 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
54 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
55 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
56 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
57 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
58 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
59 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
60 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
61 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
62 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
63 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
64 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
65 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
66 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
67 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
68 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
69 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
73 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
74 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
79 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
80 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
81 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
82 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
83 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
84 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
85 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.4
Rhizosphere 89.74
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100000009 3300005337 Bacteria 291635
2 Ga0070660_100607361 3300005339 Bacteria 915
3 Ga0070661_101857443 3300005344 Unclassified 512
4 Ga0070659_100271652 3300005366 Bacteria 1409
5 Ga0070667_100485267 3300005367 Bacteria 1132
6 Ga0070667_100530670 3300005367 Bacteria 1081
7 Ga0070714_101926613 3300005435 Unclassified 577
8 Ga0070700_101019401 3300005441 Bacteria 681
9 Ga0070679_100000258 3300005530 Bacteria 44384
10 Ga0070686_100041583 3300005544 Bacteria 2874
11 Ga0070665_100037506 3300005548 Bacteria 4875
12 Ga0070664_100064065 3300005564 Bacteria 3135
13 Ga0070664_100521275 3300005564 Bacteria 1097
14 Ga0068866_10805493 3300005718 Unclassified 653
15 Ga0068851_10003452 3300005834 Bacteria 7032
16 Ga0068870_10499411 3300005840 Bacteria 811
17 Ga0068858_100000017 3300005842 Bacteria 186913
18 Ga0068858_100422630 3300005842 Bacteria 1282
19 Ga0068860_100363577 3300005843 Bacteria 1426
20 Ga0081539_10001074 3300005985 Bacteria 49797
21 Ga0070716_100172605 3300006173 Bacteria 1412
22 Ga0075430_100620750 3300006846 Bacteria 892
23 Ga0105251_10195697 3300009011 Bacteria 911
24 Ga0105243_10508999 3300009148 Bacteria 1142
25 Ga0157370_10007930 3300013104 Bacteria 11498
26 Ga0157374_10000242 3300013296 Bacteria 50857
27 Ga0157374_10007290 3300013296 Bacteria 9426
28 Ga0157372_10000284 3300013307 Bacteria 56386
29 Ga0157372_11759804 3300013307 Bacteria 713
30 Ga0157375_10000885 3300013308 Bacteria 25959
31 Ga0163163_10951905 3300014325 Bacteria 922
32 Ga0157379_10022928 3300014968 Bacteria 5534
33 Ga0157379_11697370 3300014968 Bacteria 619
34 Ga0207656_10001076 3300025321 Bacteria 8930
35 Ga0207682_10001253 3300025893 Bacteria 11732
36 Ga0207662_10150121 3300025918 Bacteria 1482
37 Ga0207649_11623040 3300025920 Unclassified 512
38 Ga0207664_10302769 3300025929 Bacteria 1407
39 Ga0207686_10127446 3300025934 Unclassified 1741
40 Ga0207665_10179215 3300025939 Bacteria 1534
41 Ga0207661_11313958 3300025944 Bacteria 664
42 Ga0207679_10398005 3300025945 Bacteria 1211
43 Ga0207679_10713513 3300025945 Unclassified 911
44 Ga0207712_10000032 3300025961 Bacteria 210628
45 Ga0207658_10275410 3300025986 Bacteria 1440
46 Ga0207703_10000030 3300026035 Bacteria 199014
47 Ga0207703_10999648 3300026035 Bacteria 802
48 Ga0207708_10046221 3300026075 Bacteria 3316
49 Ga0207641_10196457 3300026088 Bacteria 1857
50 Ga0207675_100090817 3300026118 Bacteria 2871
51 Ga0268266_10035274 3300028379 Bacteria 4255
52 Ga0268264_10384398 3300028381 Bacteria 1345
53 Ga0373937_0038588 3300036401 Bacteria 4352
54 Ga0373937_1107523 3300036401 Bacteria 740
55 Ga0451853_1141098 3300041512 Bacteria 4160
56 Ga0495629_0719292 3300046459 Unclassified 662
57 Ga0495629_0724778 3300046459 Bacteria 659
58 Ga0495596_0021266 3300046500 Bacteria 2650
59 Ga0495608_0014780 3300046511 Bacteria 5416
60 Ga0495608_0527065 3300046511 Unclassified 714
61 Ga0495608_0628263 3300046511 Bacteria 643
62 Ga0495620_0000947 3300046515 Bacteria 17886
63 Ga0495587_0203947 3300046536 Bacteria 1118
64 Ga0495587_0266315 3300046536 Bacteria 962
65 Ga0495645_0023092 3300046543 Bacteria 4503
66 Ga0495622_0000076 3300046557 Bacteria 86777
67 Ga0495634_0000558 3300046642 Bacteria 36397
68 Ga0495634_0001012 3300046642 Bacteria 26406
69 Ga0495634_0004991 3300046642 Bacteria 10248
70 Ga0495634_0228665 3300046642 Unclassified 1145
71 Ga0495635_0057992 3300046663 Bacteria 2664
72 Ga0495635_0125844 3300046663 Bacteria 1748
73 Ga0495635_0224945 3300046663 Bacteria 1268
74 Ga0495657_0346067 3300046675 Bacteria 880
75 Ga0495599_0171032 3300046678 Bacteria 1341
76 Ga0495613_0046202 3300046689 Bacteria 3220
77 Ga0495613_0229859 3300046689 Bacteria 1300
78 Ga0495624_0000196 3300046690 Bacteria 46319
79 Ga0495624_0000711 3300046690 Bacteria 26091
80 Ga0495600_0028675 3300046809 Bacteria 3602
81 Ga0495600_0262608 3300046809 Bacteria 1096
82 Ga0495604_0275514 3300047317 Bacteria 1138
83 Ga0495604_0468037 3300047317 Unclassified 821
84 Ga0495676_0000935 3300047321 Bacteria 24540
85 Ga0495676_1004548 3300047321 Bacteria 532
86 Ga0495680_0903767 3300047322 Bacteria 570
87 Ga0495593_0111727 3300047673 Bacteria 1395
88 Ga0495602_0113032 3300048088 Bacteria 2202
89 Ga0496100_0000006 3300048903 Bacteria 297429
90 Ga0496101_0000009 3300048904 Bacteria 297429
91 Ga0496106_0000064 3300048909 Bacteria 85019
92 Ga0496107_0000002 3300048910 Bacteria 320871
93 Ga0496108_0000413 3300048911 Bacteria 34974
94 Ga0496109_0000011 3300048912 Bacteria 234908
95 Ga0496109_0000333 3300048912 Bacteria 44006
96 Ga0496109_1101587 3300048912 Bacteria 731
97 Ga0496112_0000002 3300048915 Bacteria 782039
98 Ga0496112_0003855 3300048915 Bacteria 12527
99 Ga0496113_0000382 3300048916 Bacteria 21412
100 Ga0501042_0659135 3300049578 Bacteria 761
101 Ga0501043_0625444 3300049579 Unclassified 793
102 Ga0501046_0579248 3300049580 Unclassified 798
103 Ga0501047_1301981 3300049581 Bacteria 541
104 Ga0501070_1218450 3300049586 Bacteria 577
105 Ga0501075_0940292 3300049591 Bacteria 657
106 Ga0501045_0299051 3300049824 Bacteria 1198
107 Ga0495655_0290056 3300053083 Bacteria 560
108 Ga0495595_0471581 3300053084 Bacteria 639
109 Ga0495619_0000001 3300053085 Bacteria 586054
110 Ga0495619_0000413 3300053085 Bacteria 29033
111 Ga0495619_0004779 3300053085 Bacteria 8615
112 Ga0495619_0012194 3300053085 Bacteria 5410
113 Ga0495619_0314175 3300053085 Bacteria 1085
114 Ga0495619_0483397 3300053085 Bacteria 852
115 Ga0501084_1189365 3300054114 Bacteria 640
116 Ga0501084_1426434 3300054114 Bacteria 580
117 Ga0530510_0979275 3300061734 Bacteria 647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100037506 Ga0070665_1000375063 88
2 3300013307 Ga0157372_11759804 Ga0157372_117598041 88
3 3300028379 Ga0268266_10035274 Ga0268266_100352743 88
4 3300005339 Ga0070660_100607361 Ga0070660_1006073611 89
5 3300005366 Ga0070659_100271652 Ga0070659_1002716522 89
6 3300005367 Ga0070667_100485267 Ga0070667_1004852672 89
7 3300005435 Ga0070714_101926613 Ga0070714_1019266132 89
8 3300005441 Ga0070700_101019401 Ga0070700_1010194011 89
9 3300005564 Ga0070664_100521275 Ga0070664_1005212752 89
10 3300005840 Ga0068870_10499411 Ga0068870_104994112 89
11 3300006846 Ga0075430_100620750 Ga0075430_1006207502 89
12 3300013308 Ga0157375_10000885 Ga0157375_1000088510 89
13 3300025918 Ga0207662_10150121 Ga0207662_101501211 89
14 3300025929 Ga0207664_10302769 Ga0207664_103027693 89
15 3300025945 Ga0207679_10398005 Ga0207679_103980052 89
16 3300025986 Ga0207658_10275410 Ga0207658_102754102 89
17 3300026118 Ga0207675_100090817 Ga0207675_1000908174 89
18 3300041512 Ga0451853_1141098 Ga0451853_1141098_91_366 89
19 3300046500 Ga0495596_0021266 Ga0495596_0021266_844_1113 89
20 3300046557 Ga0495622_0000076 Ga0495622_0000076_60724_61002 89
21 3300046642 Ga0495634_0004991 Ga0495634_0004991_7005_7277 89
22 3300046663 Ga0495635_0057992 Ga0495635_0057992_972_1241 89
23 3300046690 Ga0495624_0000196 Ga0495624_0000196_38748_39023 89
24 3300047321 Ga0495676_1004548 Ga0495676_1004548_27_308 89
25 3300048912 Ga0496109_1101587 Ga0496109_1101587_327_608 89
26 3300053083 Ga0495655_0290056 Ga0495655_0290056_119_388 89
27 3300053085 Ga0495619_0004779 Ga0495619_0004779_5055_5324 89
28 3300005985 Ga0081539_10001074 Ga0081539_100010747 91
29 3300049578 Ga0501042_0659135 Ga0501042_0659135_341_622 91
30 3300005367 Ga0070667_100530670 Ga0070667_1005306703 92
31 3300005544 Ga0070686_100041583 Ga0070686_1000415832 92
32 3300013104 Ga0157370_10007930 Ga0157370_100079301 92
33 3300046459 Ga0495629_0724778 Ga0495629_0724778_273_557 92
34 3300046536 Ga0495587_0266315 Ga0495587_0266315_63_347 92
35 3300046642 Ga0495634_0001012 Ga0495634_0001012_6724_7008 92
36 3300046675 Ga0495657_0346067 Ga0495657_0346067_103_396 92
37 3300049579 Ga0501043_0625444 Ga0501043_0625444_189_476 92
38 3300049580 Ga0501046_0579248 Ga0501046_0579248_419_706 92
39 3300049581 Ga0501047_1301981 Ga0501047_1301981_127_414 92
40 3300053085 Ga0495619_0314175 Ga0495619_0314175_147_440 92
41 3300054114 Ga0501084_1189365 Ga0501084_1189365_69_356 92
42 3300005718 Ga0068866_10805493 Ga0068866_108054932 93
43 3300005842 Ga0068858_100000017 Ga0068858_100000017113 93
44 3300005842 Ga0068858_100422630 Ga0068858_1004226303 93
45 3300005843 Ga0068860_100363577 Ga0068860_1003635773 93
46 3300006173 Ga0070716_100172605 Ga0070716_1001726052 93
47 3300009011 Ga0105251_10195697 Ga0105251_101956972 93
48 3300009148 Ga0105243_10508999 Ga0105243_105089992 93
49 3300013296 Ga0157374_10000242 Ga0157374_1000024234 93
50 3300013296 Ga0157374_10007290 Ga0157374_100072906 93
51 3300014325 Ga0163163_10951905 Ga0163163_109519052 93
52 3300014968 Ga0157379_10022928 Ga0157379_100229286 93
53 3300014968 Ga0157379_11697370 Ga0157379_116973702 93
54 3300025893 Ga0207682_10001253 Ga0207682_100012539 93
55 3300025934 Ga0207686_10127446 Ga0207686_101274462 93
56 3300025939 Ga0207665_10179215 Ga0207665_101792153 93
57 3300025961 Ga0207712_10000032 Ga0207712_10000032146 93
58 3300026035 Ga0207703_10000030 Ga0207703_10000030111 93
59 3300026035 Ga0207703_10999648 Ga0207703_109996482 93
60 3300026075 Ga0207708_10046221 Ga0207708_100462215 93
61 3300026088 Ga0207641_10196457 Ga0207641_101964572 93
62 3300028381 Ga0268264_10384398 Ga0268264_103843982 93
63 3300036401 Ga0373937_0038588 Ga0373937_0038588_276_557 93
64 3300036401 Ga0373937_1107523 Ga0373937_1107523_273_554 93
65 3300046459 Ga0495629_0719292 Ga0495629_0719292_311_592 93
66 3300046511 Ga0495608_0014780 Ga0495608_0014780_4690_4971 93
67 3300046511 Ga0495608_0527065 Ga0495608_0527065_363_644 93
68 3300046511 Ga0495608_0628263 Ga0495608_0628263_123_404 93
69 3300046515 Ga0495620_0000947 Ga0495620_0000947_13336_13617 93
70 3300046543 Ga0495645_0023092 Ga0495645_0023092_1477_1767 93
71 3300046642 Ga0495634_0000558 Ga0495634_0000558_15585_15875 93
72 3300046642 Ga0495634_0228665 Ga0495634_0228665_799_1083 93
73 3300046663 Ga0495635_0224945 Ga0495635_0224945_453_734 93
74 3300046678 Ga0495599_0171032 Ga0495599_0171032_339_629 93
75 3300046689 Ga0495613_0046202 Ga0495613_0046202_1517_1798 93
76 3300046689 Ga0495613_0229859 Ga0495613_0229859_805_1086 93
77 3300046690 Ga0495624_0000711 Ga0495624_0000711_4607_4894 93
78 3300046809 Ga0495600_0262608 Ga0495600_0262608_476_757 93
79 3300047317 Ga0495604_0468037 Ga0495604_0468037_99_386 93
80 3300047321 Ga0495676_0000935 Ga0495676_0000935_6853_7134 93
81 3300047322 Ga0495680_0903767 Ga0495680_0903767_94_375 93
82 3300048088 Ga0495602_0113032 Ga0495602_0113032_300_590 93
83 3300048903 Ga0496100_0000006 Ga0496100_0000006_87551_87832 93
84 3300048904 Ga0496101_0000009 Ga0496101_0000009_87551_87832 93
85 3300048909 Ga0496106_0000064 Ga0496106_0000064_68449_68730 93
86 3300048910 Ga0496107_0000002 Ga0496107_0000002_304476_304757 93
87 3300048911 Ga0496108_0000413 Ga0496108_0000413_8386_8673 93
88 3300048912 Ga0496109_0000333 Ga0496109_0000333_22874_23161 93
89 3300048915 Ga0496112_0000002 Ga0496112_0000002_11351_11653 93
90 3300053085 Ga0495619_0000001 Ga0495619_0000001_285848_286129 93
91 3300053085 Ga0495619_0000413 Ga0495619_0000413_11451_11732 93
92 3300053085 Ga0495619_0483397 Ga0495619_0483397_416_706 93
93 3300046536 Ga0495587_0203947 Ga0495587_0203947_735_1019 94
94 3300046663 Ga0495635_0125844 Ga0495635_0125844_368_652 94
95 3300046809 Ga0495600_0028675 Ga0495600_0028675_3108_3392 94
96 3300047317 Ga0495604_0275514 Ga0495604_0275514_391_675 94
97 3300053084 Ga0495595_0471581 Ga0495595_0471581_303_587 94
98 3300053085 Ga0495619_0012194 Ga0495619_0012194_4073_4357 94
99 3300005337 Ga0070682_100000009 Ga0070682_10000000963 95
100 3300005344 Ga0070661_101857443 Ga0070661_1018574431 95
101 3300005530 Ga0070679_100000258 Ga0070679_1000002589 95
102 3300005564 Ga0070664_100064065 Ga0070664_1000640653 95
103 3300005834 Ga0068851_10003452 Ga0068851_100034522 95
104 3300013307 Ga0157372_10000284 Ga0157372_100002844 95
105 3300025321 Ga0207656_10001076 Ga0207656_100010764 95
106 3300025920 Ga0207649_11623040 Ga0207649_116230402 95
107 3300025944 Ga0207661_11313958 Ga0207661_113139582 95
108 3300025945 Ga0207679_10713513 Ga0207679_107135132 95
109 3300047673 Ga0495593_0111727 Ga0495593_0111727_53_340 95
110 3300048912 Ga0496109_0000011 Ga0496109_0000011_96002_96319 95
111 3300048915 Ga0496112_0003855 Ga0496112_0003855_2773_3069 95
112 3300048916 Ga0496113_0000382 Ga0496113_0000382_15630_15926 95
113 3300049586 Ga0501070_1218450 Ga0501070_1218450_198_518 95
114 3300049591 Ga0501075_0940292 Ga0501075_0940292_309_638 95
115 3300049824 Ga0501045_0299051 Ga0501045_0299051_236_523 95
116 3300054114 Ga0501084_1426434 Ga0501084_1426434_136_456 95
117 3300061734 Ga0530510_0979275 Ga0530510_0979275_296_625 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01035

DNA_binding_1

6-O-methylguanine DNA methyltransferase, DNA binding domain

23

93

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kim-assembly1.cif.gz_A 1.7-mm microcryoprobe solution nmr structure of an o6-methylguanine dna methyltransferase family protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr247. 0.8678 7 94
4wx9-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.8598 6 77
1sfe-assembly1.cif.gz_A ada o6-methylguanine-dna methyltransferase from escherichia coli 0.8524 6 80
1t39-assembly2.cif.gz_B human o6-alkylguanine-dna alkyltransferase covalently crosslinked to dna 0.8406 7 78
4wx9-assembly1.cif.gz_C-4 crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.8354 6 77
ID Description Score Start End Superfamily
af_O05862_6_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9057 8 95 1.10.10.10
af_Q4DAC5_49_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.867 7 77 1.10.10.10
af_A4I2B3_169_261_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.864 7 77 1.10.10.10
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.861 7 77 1.10.10.10
af_A0A1D8PU47_6_130_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.855 11 91 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7V9S1N9-F1-model_v4 MGMT family protein 0.9796 8 95 GO:0003824
GO:0006281
AF-A0A538A622-F1-model_v4 MGMT family protein 0.975 7 93 GO:0003824
GO:0006281
AF-A0A7V9Q156-F1-model_v4 MGMT family protein 0.9726 11 95 GO:0003824
GO:0006281
AF-A0A838I9W6-F1-model_v4 MGMT family protein 0.9713 8 94 GO:0003824
GO:0006281
AF-A0A7V9HEM3-F1-model_v4 MGMT family protein 0.968 7 95 GO:0003824
GO:0006281

Feature Viewer

pLDDT pTM Quality
86.88 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map