F089972

General Info

Members Datasets Scaffolds Average Seq Length
116 85 50 308

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0212874|Ga0496124_0212874_303_1388
Length 361
Sequence MPGNQRILCSELGFFAFKYAVVTLHGPESGAYFSSGGLLNMKYYLSVLAGAMSYGILSTIVVLAYGQGYQLGEVVGTQLITGFILSWMLALYTRFRAKRKTQKSGNAKVNSASPAKVFTRLTWKQRLMLMAAGTPTVITGLVYYQSLRYIPASLAIILLFQFTWISVLIQAISKRQRPDKVTFLTLLILFGGTLLAAGFLEQGISNVSGIGIALGLMAAVSYSLFVLFSGKAVPSAHPAFRSAWMVTGGLILLCILFPPTFLFNGLIWSQLLVFGLLLGFFGAFIPPVLFAIGVPHIGGDMAGILGAIELPVAVLLSAIVLHEHVSLLQWFGVGIVLIGVALPELYKLRVRRSRSTPVYSG

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
3 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
4 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
5 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
6 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
7 2738543010 Bacillus sp. YR335 Isolate Unclassified
8 2738543017 Bacillus sp. OV186 Isolate Unclassified
9 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
10 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
11 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
12 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
13 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
14 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
15 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
16 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
17 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
18 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
19 2857472729 Cohnella sp. R-74144 Isolate Unclassified
20 2857586860 Bacillus sp. R-71935 Isolate Unclassified
21 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
22 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
23 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
24 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
25 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
26 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
27 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
28 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
29 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
30 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
31 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
32 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
33 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
34 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
35 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
36 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
37 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
38 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
39 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
40 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
41 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
42 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
43 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
44 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
45 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
46 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
47 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
48 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
49 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
50 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
51 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
52 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
53 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
54 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
68 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
73 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
76 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
77 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
78 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
79 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
80 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
81 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
82 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
83 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
84 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
85 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 43.1
Metatranscriptomes 0
Isolates 56.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.41
Nodule 1.72
Rhizoplane 2.59
Rhizosphere 38.79
Stem 0
Stem Tuber 0
Unclassified 34.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001185 3300003187 Bacteria 18773
2 JGI25151J46595_10001784 3300003187 Bacteria 13923
3 JGI25151J46595_10004410 3300003187 Bacteria 7451
4 JGI25151J46595_10004997 3300003187 Bacteria 6913
5 Ga0055538_1000161 3300003751 Bacteria 44428
6 Ga0055532_1000121 3300003758 Bacteria 80171
7 Ga0055536_1000225 3300003781 Bacteria 45811
8 Ga0055541_1007261 3300003841 Bacteria 1835
9 Ga0157371_10011313 3300013102 Bacteria 6887
10 Ga0209784_100194 3300025224 Bacteria 47086
11 Ga0209566_100072 3300025225 Bacteria 167764
12 Ga0209566_100135 3300025225 Bacteria 91038
13 Ga0209147_100057 3300025229 Bacteria 253870
14 Ga0209147_100062 3300025229 Bacteria 242831
15 Ga0209437_101827 3300025233 Bacteria 4559
16 Ga0209130_1013574 3300025284 Bacteria 2081
17 Ga0209676_1000192 3300025292 Bacteria 137095
18 Ga0209676_1000761 3300025292 Bacteria 43376
19 Ga0209676_1001073 3300025292 Bacteria 30983
20 Ga0209676_1012535 3300025292 Bacteria 3323
21 Ga0209676_1020108 3300025292 Bacteria 2277
22 Ga0209676_1051110 3300025292 Bacteria 1086
23 Ga0209025_1000287 3300025294 Bacteria 113923
24 Ga0209025_1000621 3300025294 Bacteria 62957
25 Ga0209025_1001790 3300025294 Bacteria 25506
26 Ga0209025_1002160 3300025294 Bacteria 21915
27 Ga0209025_1007016 3300025294 Bacteria 8541
28 Ga0207655_1037777 3300025728 Bacteria 2121
29 Ga0395899_0018391 3300037312 Bacteria 5313
30 Ga0395899_0075876 3300037312 Bacteria 2454
31 Ga0439449_0035988 3300042007 Bacteria 1841
32 Ga0439462_0012000 3300042015 Bacteria 2210
33 Ga0466969_0007145 3300044656 Bacteria 5946
34 Ga0466968_0005336 3300044735 Bacteria 4809
35 Ga0466959_0005838 3300045049 Bacteria 8475
36 Ga0495660_0028541 3300046810 Bacteria 3152
37 Ga0496102_0031523 3300048905 Bacteria 4756
38 Ga0496110_0466574 3300048913 Bacteria 1150
39 Ga0496116_0030622 3300048919 Bacteria 3862
40 Ga0496116_0034756 3300048919 Bacteria 3549
41 Ga0496116_0043605 3300048919 Bacteria 3054
42 Ga0496121_0061475 3300048924 Bacteria 3082
43 Ga0496122_0021172 3300048925 Bacteria 5834
44 Ga0496123_0019574 3300048926 Bacteria 5331
45 Ga0496124_0000793 3300048927 Bacteria 51468
46 Ga0496124_0091059 3300048927 Bacteria 2486
47 Ga0496124_0212874 3300048927 Bacteria 1461
48 Ga0496125_0009966 3300048928 Bacteria 9658
49 Ga0496125_0059417 3300048928 Bacteria 3081
50 Ga0501072_0245921 3300049588 Bacteria 1425

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046810 Ga0495660_0028541 Ga0495660_0028541_578_1504 283
2 3300042007 Ga0439449_0035988 Ga0439449_0035988_767_1690 285
3 3300042015 Ga0439462_0012000 Ga0439462_0012000_261_1184 285
4 iso_pu_bacteria 2857465823 2857471060 285
5 iso_pu_bacteria 2928510474 2928514259 287
6 iso_pu_bacteria 2593339131 2595091904 289
7 iso_pu_bacteria 2738543017 2739269360 289
8 iso_pu_bacteria 2775507177 2777761966 289
9 iso_pu_bacteria 2775507192 2777836278 289
10 iso_pu_bacteria 2788500588 2791212618 289
11 iso_pu_bacteria 2818991451 2819629289 289
12 iso_pu_bacteria 2857586860 2857589020 289
13 iso_pu_bacteria 2904606771 2904606883 289
14 iso_pu_bacteria 2928510474 2928510549 289
15 iso_pu_bacteria 3001892409 3001894025 289
16 3300013102 Ga0157371_10011313 Ga0157371_100113135 290
17 iso_pu_bacteria 2791355222 2793182883 290
18 iso_pu_bacteria 2821111986 2821113228 290
19 iso_pu_bacteria 2852673933 2852673963 290
20 iso_pu_bacteria 2857472729 2857476024 290
21 iso_pu_bacteria 2864733723 2864739004 290
22 iso_pu_bacteria 2865002811 2865004763 290
23 iso_pu_bacteria 2885526491 2885529749 290
24 iso_pu_bacteria 2889042446 2889045266 290
25 iso_pu_bacteria 2904113452 2904115393 290
26 iso_pu_bacteria 2904162308 2904165025 290
27 iso_pu_bacteria 2904490793 2904492140 290
28 iso_pu_bacteria 2919160200 2919161369 290
29 iso_pu_bacteria 2931384279 2931388699 290
30 iso_pu_bacteria 2938649242 2938655568 290
31 iso_pu_bacteria 2939679117 2939682798 290
32 iso_pu_bacteria 2945991243 2945992724 290
33 iso_pu_bacteria 2946053406 2946055476 290
34 iso_pu_bacteria 2968558590 2968559972 290
35 iso_pu_bacteria 2996632988 2996633475 290
36 iso_pu_bacteria 8054795415 8054796184 290
37 3300048913 Ga0496110_0466574 Ga0496110_0466574_105_1001 291
38 iso_pu_bacteria 2510917027 2511179067 291
39 iso_pu_bacteria 2512564013 2512638618 291
40 iso_pu_bacteria 2738543010 2739235169 291
41 iso_pu_bacteria 2738543010 2739235171 291
42 iso_pu_bacteria 2857460504 2857464025 291
43 iso_pu_bacteria 2857591370 2857593205 291
44 iso_pu_bacteria 2915597211 2915602543 291
45 iso_pu_bacteria 2915606848 2915612058 291
46 iso_pu_bacteria 2929183550 2929187706 291
47 iso_pu_bacteria 3006978542 3006983287 291
48 iso_pu_bacteria 3006984091 3006988068 291
49 3300003187 JGI25151J46595_10001784 JGI25151J46595_100017842 292
50 3300025294 Ga0209025_1000287 Ga0209025_100028735 292
51 iso_pu_bacteria 3006978542 3006983709 292
52 3300003187 JGI25151J46595_10004410 JGI25151J46595_100044105 293
53 3300003187 JGI25151J46595_10004997 JGI25151J46595_100049975 293
54 3300003758 Ga0055532_1000121 Ga0055532_100012121 293
55 3300003781 Ga0055536_1000225 Ga0055536_100022510 293
56 3300025229 Ga0209147_100062 Ga0209147_10006283 293
57 3300025284 Ga0209130_1013574 Ga0209130_10135742 293
58 3300025292 Ga0209676_1000192 Ga0209676_1000192109 293
59 3300025292 Ga0209676_1000761 Ga0209676_100076110 293
60 3300025294 Ga0209025_1007016 Ga0209025_10070167 293
61 iso_pu_bacteria 2571042143 2571528164 293
62 iso_pu_bacteria 2728368933 2728530652 293
63 iso_pu_bacteria 2938649242 2938649530 293
64 iso_pu_bacteria 2968558590 2968560063 293
65 iso_pu_bacteria 2971403814 2971405931 293
66 iso_pu_bacteria 2988225383 2988227872 293
67 iso_pu_bacteria 2996632988 2996633758 293
68 iso_pu_bacteria 8054465665 8054468188 293
69 3300025225 Ga0209566_100072 Ga0209566_10007299 294
70 3300025233 Ga0209437_101827 Ga0209437_1018272 294
71 3300025728 Ga0207655_1037777 Ga0207655_10377773 294
72 3300048919 Ga0496116_0030622 Ga0496116_0030622_1051_2016 294
73 3300048927 Ga0496124_0091059 Ga0496124_0091059_1330_2298 294
74 3300048928 Ga0496125_0009966 Ga0496125_0009966_5262_6236 294
75 3300048928 Ga0496125_0059417 Ga0496125_0059417_1654_2622 294
76 iso_pu_bacteria 2788500588 2791211466 294
77 iso_pu_bacteria 2818991451 2819628765 294
78 iso_pu_bacteria 2888578766 2888582310 294
79 iso_pu_bacteria 2889049205 2889055440 294
80 iso_pu_bacteria 2904606771 2904610763 294
81 iso_pu_bacteria 2939593269 2939596624 294
82 iso_pu_bacteria 8055531788 8055531940 294
83 3300025229 Ga0209147_100057 Ga0209147_100057125 295
84 3300049588 Ga0501072_0245921 Ga0501072_0245921_428_1336 295
85 iso_pu_bacteria 2643221676 2644423047 295
86 iso_pu_bacteria 2925326138 2925334421 295
87 3300003841 Ga0055541_1007261 Ga0055541_10072612 296
88 3300025225 Ga0209566_100135 Ga0209566_10013516 296
89 iso_pu_bacteria 2857472729 2857477815 296
90 iso_pu_bacteria 2865002811 2865006960 296
91 iso_pu_bacteria 8057977335 8057977672 296
92 3300048924 Ga0496121_0061475 Ga0496121_0061475_1239_2234 297
93 3300003751 Ga0055538_1000161 Ga0055538_100016127 298
94 3300025224 Ga0209784_100194 Ga0209784_10019429 298
95 3300025292 Ga0209676_1001073 Ga0209676_100107316 298
96 3300025292 Ga0209676_1012535 Ga0209676_10125352 298
97 3300025292 Ga0209676_1020108 Ga0209676_10201083 298
98 3300025292 Ga0209676_1051110 Ga0209676_10511101 298
99 3300025294 Ga0209025_1001790 Ga0209025_100179016 298
100 3300025294 Ga0209025_1002160 Ga0209025_100216017 298
101 3300048905 Ga0496102_0031523 Ga0496102_0031523_2719_3693 298
102 3300048919 Ga0496116_0034756 Ga0496116_0034756_1010_1945 298
103 iso_pu_bacteria 2936340661 2936344435 298
104 3300003187 JGI25151J46595_10001185 JGI25151J46595_1000118514 299
105 3300025294 Ga0209025_1000621 Ga0209025_100062144 299
106 3300037312 Ga0395899_0018391 Ga0395899_0018391_2886_3815 299
107 3300037312 Ga0395899_0075876 Ga0395899_0075876_1340_2290 299
108 3300044656 Ga0466969_0007145 Ga0466969_0007145_4861_5763 299
109 3300044735 Ga0466968_0005336 Ga0466968_0005336_606_1508 299
110 3300045049 Ga0466959_0005838 Ga0466959_0005838_4265_5167 299
111 3300048919 Ga0496116_0043605 Ga0496116_0043605_647_1705 299
112 3300048925 Ga0496122_0021172 Ga0496122_0021172_3132_4070 299
113 3300048926 Ga0496123_0019574 Ga0496123_0019574_54_1112 299
114 3300048927 Ga0496124_0000793 Ga0496124_0000793_2831_3889 299
115 3300048927 Ga0496124_0212874 Ga0496124_0212874_303_1388 299
116 iso_pu_bacteria 2757320391 2757566950 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

209

343

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.8395 9 287
7b0k-assembly1.cif.gz_A membrane protein structure 0.8386 9 287
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.8312 9 287
7b0k-assembly1.cif.gz_A membrane protein structure 0.8266 9 287
5i20-assembly3.cif.gz_C crystal structure of protein 0.7925 4 293
ID Description Score Start End Superfamily
af_A0A0R0GBE4_5_124_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7798 219 284 1.10.3730.20
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7315 5 287 1.20.1740.10
af_I1MX93_4_118_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7168 214 284 1.10.3730.20
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.695 5 287 1.20.1740.10
af_Q8RWH8_5_118_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.653 202 284 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A3D9S400-F1-model_v4 Threonine/homoserine efflux transporter RhtA 0.9808 1 290 GO:0005886
AF-A0A292YK18-F1-model_v4 EamA domain-containing protein 0.9737 5 289 GO:0005886
AF-A0A3D9S400-F1-model_v4 Threonine/homoserine efflux transporter RhtA 0.9676 1 290 GO:0005886
AF-A0A364K2Q4-F1-model_v4 Multidrug transporter 0.9648 5 287 GO:0016020
AF-A0A354DKL3-F1-model_v4 EamA family transporter 0.9624 4 290 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.24 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map