F089765

General Info

Members Datasets Scaffolds Average Seq Length
116 97 116 388

Family's Representative Sequence

Representative Sequence 3300046642|Ga0495634_0000359|Ga0495634_0000359_11970_13178
Length 377
Sequence MRRRLRAGLLLISLAGAGRRIALKRIGSFDNPVYVTGAPGAPRLLFVVEQGGKVVVLRDGHRLRRPFLDISGLVSFEGERGLLSIAFPPDYGRSGRFYAYYTDNQGNIRIDEFHRRSQTRAARGSRRQVILIPHPFNSNHNGGQMQFLGGLLYFGTGDGGSAGDPPNNAQNKNVLLGKMLRIDPRPSGGRPYSIPASNPFAGPTAGRGEIYSYGLRNPFRFSFDTAGTGAPRIAIGDVGQNRFEELDYTTVRAASGANFGWDALEGFAPYREENGGTPDPGGTTKPIFAYTHSRDGSCTIIGGYVSRDPRLPSLRGRYIYADYCEGKLRSLLPRLGGAKGDHLLGLSVESPTSFGEDDRGRLYVTSQAGPVFRLVPR

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
22 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
38 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
39 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
40 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
43 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
44 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
45 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
46 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
49 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
50 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
51 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
52 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
53 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
54 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
55 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
56 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
57 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
58 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
59 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
60 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
61 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
62 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
63 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
64 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
65 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
66 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
67 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
68 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
69 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
70 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
71 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
72 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
73 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
74 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
75 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
76 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
77 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
78 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
81 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
84 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
91 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
92 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
93 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
94 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
95 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
96 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
97 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 12.93
Rhizosphere 84.48
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10000300 3300003659 Bacteria 6462
2 Ga0070682_100000009 3300005337 Bacteria 291635
3 Ga0070689_100055170 3300005340 Bacteria 3078
4 Ga0070671_100061144 3300005355 Bacteria 3136
5 Ga0070673_100007106 3300005364 Bacteria 7354
6 Ga0070688_100005492 3300005365 Bacteria 6682
7 Ga0070688_100086053 3300005365 Unclassified 2044
8 Ga0070713_100000239 3300005436 Bacteria 36304
9 Ga0070711_100100315 3300005439 Unclassified 2105
10 Ga0070685_10005058 3300005466 Bacteria 6685
11 Ga0068856_100026405 3300005614 Bacteria 5663
12 Ga0068852_100000024 3300005616 Bacteria 120479
13 Ga0068863_100000050 3300005841 Bacteria 130200
14 Ga0068860_100050004 3300005843 Bacteria 3981
15 Ga0081540_1000545 3300005983 Bacteria 36477
16 Ga0068865_100000024 3300006881 Bacteria 94969
17 Ga0105245_10014841 3300009098 Bacteria 6785
18 Ga0105242_10000421 3300009176 Bacteria 33769
19 Ga0105242_10117242 3300009176 Bacteria 2279
20 Ga0105249_10000054 3300009553 Bacteria 162883
21 Ga0157370_10035743 3300013104 Bacteria 4826
22 Ga0157369_10000068 3300013105 Bacteria 144274
23 Ga0157378_10026341 3300013297 Bacteria 5126
24 Ga0207710_10000356 3300025900 Bacteria 32450
25 Ga0207687_10000025 3300025927 Bacteria 175177
26 Ga0207687_10000109 3300025927 Bacteria 59406
27 Ga0207700_10000019 3300025928 Bacteria 183117
28 Ga0207690_10017980 3300025932 Bacteria 4329
29 Ga0207686_10000416 3300025934 Bacteria 29091
30 Ga0207670_10084316 3300025936 Unclassified 2231
31 Ga0207704_10000054 3300025938 Bacteria 79155
32 Ga0207651_10002955 3300025960 Bacteria 8220
33 Ga0207712_10000032 3300025961 Bacteria 210628
34 Ga0207668_10035910 3300025972 Bacteria 3305
35 Ga0207639_10100943 3300026041 Bacteria 2332
36 Ga0207702_10013553 3300026078 Bacteria 6772
37 Ga0207641_10000436 3300026088 Bacteria 47925
38 Ga0207698_10000014 3300026142 Bacteria 240703
39 Ga0268264_10040267 3300028381 Bacteria 3861
40 Ga0265337_1000060 3300028556 Bacteria 49697
41 Ga0265326_10000056 3300028558 Bacteria 64840
42 Ga0265319_1000037 3300028563 Bacteria 115642
43 Ga0265322_10000017 3300028654 Bacteria 114833
44 Ga0265338_10000051 3300028800 Bacteria 211202
45 Ga0265324_10000196 3300029957 Bacteria 46096
46 Ga0265320_10000068 3300031240 Bacteria 91884
47 Ga0265325_10082959 3300031241 Bacteria 1590
48 Ga0265329_10005649 3300031242 Bacteria 5031
49 Ga0265331_10001724 3300031250 Bacteria 15748
50 Ga0265327_10000317 3300031251 Bacteria 92215
51 Ga0265314_10000441 3300031711 Bacteria 55548
52 Ga0265342_10099013 3300031712 Bacteria 1663
53 Ga0451853_3195697 3300041512 Bacteria 2452
54 Ga0466963_0002221 3300044694 Bacteria 10750
55 Ga0466963_0109215 3300044694 Unclassified 1897
56 Ga0466967_0069493 3300045976 Bacteria 3148
57 Ga0495629_0001594 3300046459 Bacteria 17849
58 Ga0495629_0001912 3300046459 Bacteria 16225
59 Ga0495594_0000001 3300046499 Bacteria 293051
60 Ga0495608_0000042 3300046511 Bacteria 115906
61 Ga0495628_0000628 3300046516 Bacteria 32247
62 Ga0495630_0034995 3300046517 Bacteria 3752
63 Ga0495630_0058898 3300046517 Bacteria 2880
64 Ga0495652_0000009 3300046529 Bacteria 311000
65 Ga0495587_0066499 3300046536 Bacteria 2102
66 Ga0495622_0000033 3300046557 Bacteria 124162
67 Ga0495667_0000019 3300046559 Bacteria 181645
68 Ga0495634_0000359 3300046642 Bacteria 44267
69 Ga0495635_0019618 3300046663 Bacteria 4710
70 Ga0495657_0000040 3300046675 Bacteria 115899
71 Ga0495658_0002027 3300046683 Bacteria 10310
72 Ga0495658_0099233 3300046683 Bacteria 1736
73 Ga0495669_0000420 3300046684 Bacteria 20393
74 Ga0495613_0002048 3300046689 Bacteria 15327
75 Ga0495600_0018413 3300046809 Bacteria 4450
76 Ga0495604_0005169 3300047317 Bacteria 10334
77 Ga0495604_0052041 3300047317 Bacteria 3173
78 Ga0495674_0000589 3300047319 Bacteria 34001
79 Ga0495676_0035371 3300047321 Bacteria 4179
80 Ga0495680_0001728 3300047322 Bacteria 23182
81 Ga0495680_0005339 3300047322 Bacteria 12122
82 Ga0495680_0042253 3300047322 Bacteria 3619
83 Ga0495675_0000051 3300047444 Bacteria 80375
84 Ga0495675_0036058 3300047444 Bacteria 3156
85 Ga0495686_0031062 3300047472 Bacteria 3466
86 Ga0495593_0026372 3300047673 Bacteria 3209
87 Ga0495602_0000038 3300048088 Bacteria 130758
88 Ga0495602_0005333 3300048088 Bacteria 13494
89 Ga0496100_0000028 3300048903 Bacteria 113912
90 Ga0496101_0000005 3300048904 Bacteria 331455
91 Ga0496102_0000021 3300048905 Bacteria 246920
92 Ga0496103_0000001 3300048906 Bacteria 643471
93 Ga0496104_0060459 3300048907 Bacteria 3589
94 Ga0496105_0000003 3300048908 Bacteria 713251
95 Ga0496105_0022502 3300048908 Bacteria 5105
96 Ga0496106_0000033 3300048909 Bacteria 131412
97 Ga0496107_0000004 3300048910 Bacteria 297680
98 Ga0496108_0000042 3300048911 Bacteria 146397
99 Ga0496109_0000034 3300048912 Bacteria 160397
100 Ga0496112_0000002 3300048915 Bacteria 782039
101 Ga0496114_0000003 3300048917 Bacteria 630981
102 Ga0496115_0000005 3300048918 Bacteria 290756
103 Ga0496115_0000036 3300048918 Bacteria 127774
104 Ga0501070_0040621 3300049586 Bacteria 3879
105 nmdc:mga0rr50_50888_c1 3300050513 Bacteria 3071
106 Ga0495601_0013930 3300053077 Bacteria 4842
107 Ga0495655_0000008 3300053083 Bacteria 153535
108 Ga0495655_0005044 3300053083 Bacteria 2304
109 Ga0495595_0000009 3300053084 Bacteria 193039
110 Ga0495595_0008609 3300053084 Bacteria 4196
111 Ga0495619_0000057 3300053085 Bacteria 93948
112 Ga0495619_0000119 3300053085 Bacteria 58302
113 Ga0495619_0002467 3300053085 Bacteria 12097
114 Ga0495619_0017622 3300053085 Bacteria 4524
115 Ga0500566_0001814 3300053094 Bacteria 12548
116 Ga0500628_000023 3300053129 Bacteria 77818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046683 Ga0495658_0099233 Ga0495658_0099233_52_1047 330
2 3300053083 Ga0495655_0005044 Ga0495655_0005044_1261_2253 330
3 3300048088 Ga0495602_0005333 Ga0495602_0005333_2953_3948 331
4 3300046684 Ga0495669_0000420 Ga0495669_0000420_7358_8431 354
5 3300005365 Ga0070688_100005492 Ga0070688_1000054924 358
6 3300005466 Ga0070685_10005058 Ga0070685_100050584 358
7 3300005616 Ga0068852_100000024 Ga0068852_10000002497 363
8 3300026142 Ga0207698_10000014 Ga0207698_10000014152 363
9 3300013104 Ga0157370_10035743 Ga0157370_100357434 364
10 3300048907 Ga0496104_0060459 Ga0496104_0060459_971_2206 364
11 3300047673 Ga0495593_0026372 Ga0495593_0026372_1497_2666 367
12 3300045976 Ga0466967_0069493 Ga0466967_0069493_837_2039 369
13 3300028563 Ga0265319_1000037 Ga0265319_1000037100 370
14 3300028800 Ga0265338_10000051 Ga0265338_10000051201 370
15 3300031241 Ga0265325_10082959 Ga0265325_100829591 370
16 3300031712 Ga0265342_10099013 Ga0265342_100990131 370
17 3300005614 Ga0068856_100026405 Ga0068856_1000264054 371
18 3300025927 Ga0207687_10000025 Ga0207687_10000025115 371
19 3300026078 Ga0207702_10013553 Ga0207702_100135534 371
20 3300047317 Ga0495604_0052041 Ga0495604_0052041_1785_2903 371
21 3300048088 Ga0495602_0000038 Ga0495602_0000038_117988_119106 371
22 3300053084 Ga0495595_0008609 Ga0495595_0008609_2190_3308 371
23 3300025972 Ga0207668_10035910 Ga0207668_100359104 372
24 3300026041 Ga0207639_10100943 Ga0207639_101009433 372
25 3300046809 Ga0495600_0018413 Ga0495600_0018413_1900_3063 373
26 3300046642 Ga0495634_0000359 Ga0495634_0000359_11970_13178 375
27 3300048911 Ga0496108_0000042 Ga0496108_0000042_26184_27368 375
28 3300048912 Ga0496109_0000034 Ga0496109_0000034_58823_60007 375
29 3300048915 Ga0496112_0000002 Ga0496112_0000002_118101_119288 375
30 3300006881 Ga0068865_100000024 Ga0068865_1000000245 376
31 3300025938 Ga0207704_10000054 Ga0207704_1000005475 376
32 3300046683 Ga0495658_0002027 Ga0495658_0002027_3726_4859 376
33 3300046536 Ga0495587_0066499 Ga0495587_0066499_936_2081 377
34 3300047322 Ga0495680_0001728 Ga0495680_0001728_16891_18039 377
35 3300005364 Ga0070673_100007106 Ga0070673_1000071065 378
36 3300025960 Ga0207651_10002955 Ga0207651_100029554 378
37 3300047317 Ga0495604_0005169 Ga0495604_0005169_5884_7056 378
38 3300005340 Ga0070689_100055170 Ga0070689_1000551703 379
39 3300013105 Ga0157369_10000068 Ga0157369_1000006838 379
40 3300025932 Ga0207690_10017980 Ga0207690_100179802 379
41 3300025936 Ga0207670_10084316 Ga0207670_100843163 379
42 3300046689 Ga0495613_0002048 Ga0495613_0002048_11855_13036 379
43 3300046459 Ga0495629_0001912 Ga0495629_0001912_11180_12373 381
44 3300053094 Ga0500566_0001814 Ga0500566_0001814_8969_10162 381
45 3300005843 Ga0068860_100050004 Ga0068860_1000500043 382
46 3300028381 Ga0268264_10040267 Ga0268264_100402671 382
47 3300005436 Ga0070713_100000239 Ga0070713_10000023924 383
48 3300025928 Ga0207700_10000019 Ga0207700_1000001982 383
49 3300046511 Ga0495608_0000042 Ga0495608_0000042_64657_65841 383
50 3300046675 Ga0495657_0000040 Ga0495657_0000040_64657_65841 383
51 3300047444 Ga0495675_0000051 Ga0495675_0000051_64629_65813 383
52 3300047472 Ga0495686_0031062 Ga0495686_0031062_2238_3437 383
53 3300053084 Ga0495595_0000009 Ga0495595_0000009_127199_128383 383
54 3300053085 Ga0495619_0000057 Ga0495619_0000057_50058_51242 383
55 3300013297 Ga0157378_10026341 Ga0157378_100263414 384
56 3300049586 Ga0501070_0040621 Ga0501070_0040621_2545_3705 384
57 3300009098 Ga0105245_10014841 Ga0105245_100148415 386
58 3300025927 Ga0207687_10000109 Ga0207687_1000010954 386
59 3300025961 Ga0207712_10000032 Ga0207712_1000003233 386
60 3300046663 Ga0495635_0019618 Ga0495635_0019618_1568_2770 386
61 3300053085 Ga0495619_0000119 Ga0495619_0000119_49367_50536 386
62 3300053085 Ga0495619_0017622 Ga0495619_0017622_299_1501 386
63 3300005365 Ga0070688_100086053 Ga0070688_1000860532 388
64 3300005439 Ga0070711_100100315 Ga0070711_1001003152 388
65 3300005841 Ga0068863_100000050 Ga0068863_10000005049 388
66 3300026088 Ga0207641_10000436 Ga0207641_1000043642 388
67 3300009176 Ga0105242_10117242 Ga0105242_101172422 389
68 3300041512 Ga0451853_3195697 Ga0451853_3195697_414_1592 389
69 3300047322 Ga0495680_0042253 Ga0495680_0042253_318_1502 389
70 3300046516 Ga0495628_0000628 Ga0495628_0000628_17428_18615 390
71 3300005337 Ga0070682_100000009 Ga0070682_100000009173 391
72 3300009176 Ga0105242_10000421 Ga0105242_100004215 391
73 3300009553 Ga0105249_10000054 Ga0105249_10000054132 391
74 3300025900 Ga0207710_10000356 Ga0207710_100003567 391
75 3300025934 Ga0207686_10000416 Ga0207686_100004166 391
76 3300028556 Ga0265337_1000060 Ga0265337_100006044 391
77 3300028558 Ga0265326_10000056 Ga0265326_1000005657 391
78 3300028654 Ga0265322_10000017 Ga0265322_10000017103 391
79 3300029957 Ga0265324_10000196 Ga0265324_1000019636 391
80 3300031240 Ga0265320_10000068 Ga0265320_1000006821 391
81 3300031242 Ga0265329_10005649 Ga0265329_100056495 391
82 3300031250 Ga0265331_10001724 Ga0265331_1000172413 391
83 3300031251 Ga0265327_10000317 Ga0265327_1000031721 391
84 3300031711 Ga0265314_10000441 Ga0265314_1000044124 391
85 3300044694 Ga0466963_0002221 Ga0466963_0002221_7359_8561 391
86 3300044694 Ga0466963_0109215 Ga0466963_0109215_346_1572 391
87 3300046517 Ga0495630_0034995 Ga0495630_0034995_1191_2393 391
88 3300046517 Ga0495630_0058898 Ga0495630_0058898_393_1595 391
89 3300046559 Ga0495667_0000019 Ga0495667_0000019_8108_9307 391
90 3300047322 Ga0495680_0005339 Ga0495680_0005339_1055_2254 391
91 3300048905 Ga0496102_0000021 Ga0496102_0000021_89544_90734 391
92 3300048906 Ga0496103_0000001 Ga0496103_0000001_505173_506363 391
93 3300048908 Ga0496105_0000003 Ga0496105_0000003_387604_388815 391
94 3300048908 Ga0496105_0022502 Ga0496105_0022502_3002_4216 391
95 3300050513 nmdc:mga0rr50_50888_c1 nmdc:mga0rr50_50888_c1_1142_2329 391
96 3300053077 Ga0495601_0013930 Ga0495601_0013930_1909_3111 391
97 3300053085 Ga0495619_0002467 Ga0495619_0002467_9256_10458 391
98 3300003659 JGI25404J52841_10000300 JGI25404J52841_100003004 392
99 3300005355 Ga0070671_100061144 Ga0070671_1000611442 392
100 3300005983 Ga0081540_1000545 Ga0081540_10005455 392
101 3300046459 Ga0495629_0001594 Ga0495629_0001594_1512_2705 392
102 3300046499 Ga0495594_0000001 Ga0495594_0000001_125214_126419 392
103 3300046529 Ga0495652_0000009 Ga0495652_0000009_136181_137383 392
104 3300046557 Ga0495622_0000033 Ga0495622_0000033_38445_39650 392
105 3300047319 Ga0495674_0000589 Ga0495674_0000589_11416_12615 392
106 3300047321 Ga0495676_0035371 Ga0495676_0035371_1217_2410 392
107 3300047444 Ga0495675_0036058 Ga0495675_0036058_1097_2290 392
108 3300048903 Ga0496100_0000028 Ga0496100_0000028_2096_3328 392
109 3300048904 Ga0496101_0000005 Ga0496101_0000005_152095_153327 392
110 3300048909 Ga0496106_0000033 Ga0496106_0000033_102084_103316 392
111 3300048910 Ga0496107_0000004 Ga0496107_0000004_152312_153544 392
112 3300048917 Ga0496114_0000003 Ga0496114_0000003_233857_235050 392
113 3300048918 Ga0496115_0000005 Ga0496115_0000005_29813_31036 392
114 3300048918 Ga0496115_0000036 Ga0496115_0000036_34718_35911 392
115 3300053083 Ga0495655_0000008 Ga0495655_0000008_49974_51167 392
116 3300053129 Ga0500628_000023 Ga0500628_000023_4888_6081 392

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

29

331

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a9h-assembly1.cif.gz_A crystal structure of pqq-dependent sugar dehydrogenase holo-form 0.7845 36 391
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.7819 37 387
3a9h-assembly1.cif.gz_A crystal structure of pqq-dependent sugar dehydrogenase holo-form 0.7718 36 391
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.7688 37 387
2ism-assembly1.cif.gz_A crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8 0.7642 36 389
ID Description Score Start End Superfamily
af_Q14DK5_187_578_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8105 38 387 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7668 36 391 2.120.10.30
af_Q2QLJ8_215_613_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7653 46 363 2.120.10.30
2ismB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7631 36 389 2.120.10.30
2ismB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7589 36 389 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A7V9T5A7-F1-model_v4 PQQ-dependent sugar dehydrogenase 0.9401 39 199
AF-A0A3B0S8I4-F1-model_v4 Glucose/Sorbosone dehydrogenase domain-containing protein 0.936 39 128
AF-A0A4Q2Y730-F1-model_v4 Glucose dehydrogenase 0.9346 39 163
AF-A0A3N5M790-F1-model_v4 Glucose dehydrogenase 0.9294 39 192
AF-A0A7V4U1X3-F1-model_v4 Glucose sorbosone dehydrogenase 0.9045 44 198

Feature Viewer

pLDDT pTM Quality
73.33 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map