F083558

General Info

Members Datasets Scaffolds Average Seq Length
115 84 230 146

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10325838|Ga0105237_103258382
Length 145
Sequence MSAKKAFSEAEQQAIVQSIKDAEKDTSGEIRVHLDKTCSGDPYKRAIKVFEKLGMHKTAQRNGVLFYLSTEDHKLAIIGDKGINEKVPADFWNAILEETIHSFKQGKMTEGLSSGIAKAGQQLSAFFPYQKNDHNELSNDISFEN

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
72 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
75 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
81 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
82 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
83 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
84 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.87
Rhizosphere 94.78
Stem 0
Stem Tuber 0
Unclassified 9.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10325838 3300009545 Bacteria 1540
2 Ga0065715_10253873 3300005293 Bacteria 1158
3 Ga0070658_10022959 3300005327 Bacteria 5008
4 Ga0070683_100000054 3300005329 Bacteria 87927
5 Ga0070683_101122952 3300005329 Bacteria 755
6 Ga0070670_100000041 3300005331 Bacteria 147849
7 Ga0070670_101303214 3300005331 Bacteria 665
8 Ga0070680_100108405 3300005336 Bacteria 2310
9 Ga0070682_100097839 3300005337 Bacteria 1932
10 Ga0070692_10011869 3300005345 Bacteria 4016
11 Ga0070675_100000009 3300005354 Bacteria 245759
12 Ga0070709_10813285 3300005434 Bacteria 734
13 Ga0070713_100033701 3300005436 Bacteria 4106
14 Ga0070700_100000084 3300005441 Bacteria 62644
15 Ga0068867_101047351 3300005459 Bacteria 742
16 Ga0070706_100103482 3300005467 Bacteria 2647
17 Ga0070707_100051228 3300005468 Bacteria 3958
18 Ga0070707_100268310 3300005468 Bacteria 1660
19 Ga0070707_100554453 3300005468 Bacteria 1111
20 Ga0070698_100397586 3300005471 Bacteria 1311
21 Ga0070699_100110570 3300005518 Bacteria 2412
22 Ga0070684_100002141 3300005535 Bacteria 14568
23 Ga0070684_100106409 3300005535 Bacteria 2511
24 Ga0070697_101412411 3300005536 Bacteria 622
25 Ga0070697_101632155 3300005536 Unclassified 577
26 Ga0070672_100000941 3300005543 Bacteria 17500
27 Ga0070696_101194776 3300005546 Bacteria 642
28 Ga0068857_101848176 3300005577 Unclassified 591
29 Ga0068854_100005460 3300005578 Bacteria 8029
30 Ga0068861_101272305 3300005719 Bacteria 714
31 Ga0070717_10001923 3300006028 Bacteria 14507
32 Ga0070717_11622064 3300006028 Unclassified 586
33 Ga0068871_100066698 3300006358 Bacteria 2951
34 Ga0075428_100593285 3300006844 Bacteria 1183
35 Ga0075434_100783481 3300006871 Bacteria 970
36 Ga0075436_100006565 3300006914 Bacteria 7965
37 Ga0075435_100026180 3300007076 Bacteria 4548
38 Ga0105244_10048074 3300009036 Unclassified 2185
39 Ga0105245_10000904 3300009098 Bacteria 26985
40 Ga0105245_10003042 3300009098 Bacteria 15027
41 Ga0105245_10017322 3300009098 Bacteria 6285
42 Ga0105245_10044473 3300009098 Bacteria 3963
43 Ga0114129_10044230 3300009147 Bacteria 6264
44 Ga0114129_12527129 3300009147 Bacteria 614
45 Ga0105248_11565294 3300009177 Bacteria 746
46 Ga0105238_10000001 3300009551 Bacteria 2036163
47 Ga0105239_10319311 3300010375 Bacteria 1751
48 Ga0157369_11737205 3300013105 Bacteria 634
49 Ga0157374_10000010 3300013296 Bacteria 505635
50 Ga0157378_10000220 3300013297 Bacteria 55469
51 Ga0157378_10028696 3300013297 Bacteria 4912
52 Ga0157378_10263778 3300013297 Bacteria 1654
53 Ga0157378_11962821 3300013297 Bacteria 635
54 Ga0163162_10020563 3300013306 Bacteria 6485
55 Ga0157375_10000015 3300013308 Bacteria 308254
56 Ga0157375_10000035 3300013308 Bacteria 179166
57 Ga0157375_10000303 3300013308 Bacteria 44672
58 Ga0157375_10742275 3300013308 Bacteria 1133
59 Ga0163163_10443918 3300014325 Bacteria 1357
60 Ga0157377_10000019 3300014745 Bacteria 171658
61 Ga0157377_10000362 3300014745 Bacteria 20278
62 Ga0157376_10000049 3300014969 Bacteria 104672
63 Ga0213873_10022488 3300021358 Bacteria 1493
64 Ga0213876_10000012 3300021384 Bacteria 396530
65 Ga0207645_10695403 3300025907 Unclassified 691
66 Ga0207643_10017878 3300025908 Bacteria 3882
67 Ga0207705_10132099 3300025909 Unclassified 1858
68 Ga0207684_10022559 3300025910 Bacteria 5374
69 Ga0207684_10104357 3300025910 Bacteria 2424
70 Ga0207684_10140283 3300025910 Bacteria 2077
71 Ga0207660_10086946 3300025917 Bacteria 2309
72 Ga0207662_10029382 3300025918 Bacteria 3185
73 Ga0207646_10248056 3300025922 Unclassified 1608
74 Ga0207646_10423798 3300025922 Unclassified 1201
75 Ga0207646_10534333 3300025922 Bacteria 1055
76 Ga0207694_10000001 3300025924 Bacteria 4078485
77 Ga0207650_10000088 3300025925 Bacteria 123236
78 Ga0207650_10522401 3300025925 Bacteria 993
79 Ga0207659_10000007 3300025926 Bacteria 322984
80 Ga0207687_10000157 3300025927 Bacteria 45617
81 Ga0207687_10001520 3300025927 Bacteria 15891
82 Ga0207687_10006433 3300025927 Bacteria 7759
83 Ga0207687_10267216 3300025927 Bacteria 1366
84 Ga0207700_10039631 3300025928 Bacteria 3432
85 Ga0207691_10002608 3300025940 Bacteria 17602
86 Ga0207689_10062699 3300025942 Bacteria 3057
87 Ga0207661_10000001 3300025944 Bacteria 937688
88 Ga0207661_11188552 3300025944 Bacteria 702
89 Ga0207679_10805305 3300025945 Bacteria 857
90 Ga0207640_10005065 3300025981 Bacteria 7171
91 Ga0207677_10000041 3300026023 Bacteria 111195
92 Ga0207677_10000089 3300026023 Bacteria 76102
93 Ga0207639_10000003 3300026041 Bacteria 806887
94 Ga0207708_10000001 3300026075 Bacteria 467100
95 Ga0207648_11119134 3300026089 Bacteria 739
96 Ga0207674_10068222 3300026116 Bacteria 3579
97 Ga0207674_10711927 3300026116 Unclassified 969
98 Ga0307511_10005969 3300030521 Bacteria 12302
99 Ga0307416_100612273 3300032002 Bacteria 1170
100 Ga0373932_0000223 3300035112 Bacteria 16939
101 Ga0373941_0210800 3300035115 Unclassified 743
102 Ga0436365_0487735 3300039437 Bacteria 6289
103 Ga0436365_0800228 3300039437 Bacteria 36005
104 Ga0436362_0983754 3300039453 Bacteria 1696
105 Ga0451839_0326203 3300041496 Bacteria 761
106 Ga0451577_1951014 3300042876 Bacteria 514
107 Ga0453683_0519362 3300044673 Bacteria 773
108 Ga0466960_0066922 3300044901 Bacteria 1778
109 Ga0496112_1319780 3300048915 Unclassified 637
110 Ga0501073_0003561 3300049589 Bacteria 11703
111 Ga0501080_0008792 3300049742 Bacteria 9178
112 nmdc:mga0rr50_21190_c1 3300050513 Bacteria 4432
113 nmdc:mga0rr50_53_c1 3300050513 Bacteria 63727
114 nmdc:mga08x19_2211_c1 3300050514 Bacteria 11889
115 Ga0495655_0000519 3300053083 Bacteria 6332
116 Ga0105237_10325838
117 Ga0065715_10253873
118 Ga0070658_10022959
119 Ga0070683_100000054
120 Ga0070683_101122952
121 Ga0070670_100000041
122 Ga0070670_101303214
123 Ga0070680_100108405
124 Ga0070682_100097839
125 Ga0070692_10011869
126 Ga0070675_100000009
127 Ga0070709_10813285
128 Ga0070713_100033701
129 Ga0070700_100000084
130 Ga0068867_101047351
131 Ga0070706_100103482
132 Ga0070707_100051228
133 Ga0070707_100268310
134 Ga0070707_100554453
135 Ga0070698_100397586
136 Ga0070699_100110570
137 Ga0070684_100002141
138 Ga0070684_100106409
139 Ga0070697_101412411
140 Ga0070697_101632155
141 Ga0070672_100000941
142 Ga0070696_101194776
143 Ga0068857_101848176
144 Ga0068854_100005460
145 Ga0068861_101272305
146 Ga0070717_10001923
147 Ga0070717_11622064
148 Ga0068871_100066698
149 Ga0075428_100593285
150 Ga0075434_100783481
151 Ga0075436_100006565
152 Ga0075435_100026180
153 Ga0105244_10048074
154 Ga0105245_10000904
155 Ga0105245_10003042
156 Ga0105245_10017322
157 Ga0105245_10044473
158 Ga0114129_10044230
159 Ga0114129_12527129
160 Ga0105248_11565294
161 Ga0105238_10000001
162 Ga0105239_10319311
163 Ga0157369_11737205
164 Ga0157374_10000010
165 Ga0157378_10000220
166 Ga0157378_10028696
167 Ga0157378_10263778
168 Ga0157378_11962821
169 Ga0163162_10020563
170 Ga0157375_10000015
171 Ga0157375_10000035
172 Ga0157375_10000303
173 Ga0157375_10742275
174 Ga0163163_10443918
175 Ga0157377_10000019
176 Ga0157377_10000362
177 Ga0157376_10000049
178 Ga0213873_10022488
179 Ga0213876_10000012
180 Ga0207645_10695403
181 Ga0207643_10017878
182 Ga0207705_10132099
183 Ga0207684_10022559
184 Ga0207684_10104357
185 Ga0207684_10140283
186 Ga0207660_10086946
187 Ga0207662_10029382
188 Ga0207646_10248056
189 Ga0207646_10423798
190 Ga0207646_10534333
191 Ga0207694_10000001
192 Ga0207650_10000088
193 Ga0207650_10522401
194 Ga0207659_10000007
195 Ga0207687_10000157
196 Ga0207687_10001520
197 Ga0207687_10006433
198 Ga0207687_10267216
199 Ga0207700_10039631
200 Ga0207691_10002608
201 Ga0207689_10062699
202 Ga0207661_10000001
203 Ga0207661_11188552
204 Ga0207679_10805305
205 Ga0207640_10005065
206 Ga0207677_10000041
207 Ga0207677_10000089
208 Ga0207639_10000003
209 Ga0207708_10000001
210 Ga0207648_11119134
211 Ga0207674_10068222
212 Ga0207674_10711927
213 Ga0307511_10005969
214 Ga0307416_100612273
215 Ga0373932_0000223
216 Ga0373941_0210800
217 Ga0436365_0487735
218 Ga0436365_0800228
219 Ga0436362_0983754
220 Ga0451839_0326203
221 Ga0451577_1951014
222 Ga0453683_0519362
223 Ga0466960_0066922
224 Ga0496112_1319780
225 Ga0501073_0003561
226 Ga0501080_0008792
227 nmdc:mga0rr50_21190_c1
228 nmdc:mga0rr50_53_c1
229 nmdc:mga08x19_2211_c1
230 Ga0495655_0000519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04536

TPM_phosphatase

TPM domain

2

122

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.9363 12 144
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.8624 12 144
2kw7-assembly1.cif.gz_A solution nmr structure of the n-terminal domain of protein pg_0361 from p.gingivalis, northeast structural genomics consortium target pgr37a 0.8059 17 127
3ptj-assembly1.cif.gz_A structural and functional analysis of arabidopsis thaliana thylakoid lumen protein attlp18.3 0.7952 7 125
7e1v-assembly1.cif.gz_J cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv 0.7929 13 120
ID Description Score Start End Superfamily
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9363 12 144 3.10.310.50
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8624 12 144 3.10.310.50
af_P75961_32_162_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8161 11 125 3.10.310.50
2kw7A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8059 17 127 3.10.310.50
af_Q4D9T4_132_267_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8024 13 122 3.10.310.50
ID Description Score Start End GO Terms
AF-A0A2V7W2C3-F1-model_v4 TPM domain-containing protein 0.9837 1 144 GO:0016020
AF-A0A2V7WES2-F1-model_v4 TPM domain-containing protein 0.9818 1 144 GO:0016020
AF-A0A7C3MMQ1-F1-model_v4 TPM domain-containing protein 0.9798 12 144 GO:0016020
AF-A0A2V7W2C3-F1-model_v4 TPM domain-containing protein 0.977 1 144 GO:0016020
AF-A0A1S2VG70-F1-model_v4 TPM domain-containing protein 0.976 12 144 GO:0016020

Map