F078475

General Info

Members Datasets Scaffolds Average Seq Length
114 77 110 348

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10000817|Ga0105247_1000081722
Length 384
Sequence LQFTELACPEFVKVITFISFQAISKYIKFIVRLYYEIMMRVAIIFLLFFHLLCSVSLAQKKIKPGIVSGKTPCMDAIGLFTRPKVPLMAAQEEFAPLITSTQNPPVNLPGNGLAQHTMLYIGENCNRMSLVKDGQVIWTYSTGTGPEYDDVWMLSNGNILFTRMQYIAEITPDKKIVWRYDCNNTKGSGHTEVHTCQPIGLDKVMFVVNGLPPKLMIVNTKTGKIEVEHNIPYDGPPEQNDIHAQFRRVRITAKGTYLVSYLLKNRVVEYDKNFKERWSYNISSPWAAIRLKSGNTLITNEKEWLTREVNTKGETVWEFNCKTDLPAPYQFTRGKQGTGPQLIEVTRDKKVVWVLHDWKNLGDASAVQILDDPGFPEIPGQSEH

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
5 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
15 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
16 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
29 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
46 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
47 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
48 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
49 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
52 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
53 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
54 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
55 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
67 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
68 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
69 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
70 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
71 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
72 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
76 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
77 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.26
Nodule 0
Rhizoplane 0.88
Rhizosphere 92.98
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000525 3300001990 Bacteria 13471
2 Ga0070669_100029389 3300005353 Bacteria 3961
3 Ga0070675_100027389 3300005354 Bacteria 4578
4 Ga0068853_100000046 3300005539 Bacteria 96446
5 Ga0068853_100349411 3300005539 Bacteria 1375
6 Ga0070693_100083239 3300005547 Bacteria 1912
7 Ga0068855_100022524 3300005563 Bacteria 7550
8 Ga0068857_100074410 3300005577 Unclassified 3026
9 Ga0068857_100173208 3300005577 Bacteria 1962
10 Ga0068856_100000548 3300005614 Bacteria 41472
11 Ga0068856_100074637 3300005614 Unclassified 3358
12 Ga0068852_100112862 3300005616 Bacteria 2474
13 Ga0068859_100017762 3300005617 Bacteria 7151
14 Ga0068861_100156201 3300005719 Bacteria 1877
15 Ga0068851_10135780 3300005834 Bacteria 1334
16 Ga0075367_10044853 3300006178 Bacteria 2593
17 Ga0075366_10024157 3300006195 Bacteria 3545
18 Ga0075370_10028385 3300006353 Bacteria 3110
19 Ga0097620_100017762 3300006931 Bacteria 7151
20 Ga0105240_10000002 3300009093 Bacteria 1924170
21 Ga0105240_10351851 3300009093 Bacteria 1671
22 Ga0105245_10314735 3300009098 Unclassified 1540
23 Ga0105247_10000817 3300009101 Bacteria 23717
24 Ga0105238_10096030 3300009551 Unclassified 2950
25 Ga0105238_10190054 3300009551 Bacteria 2030
26 Ga0105249_10005856 3300009553 Bacteria 10636
27 Ga0105239_10000005 3300010375 Bacteria 496066
28 Ga0105239_10021112 3300010375 Bacteria 7184
29 Ga0157373_10007129 3300013100 Bacteria 8337
30 Ga0157373_10193246 3300013100 Bacteria 1434
31 Ga0157371_10001721 3300013102 Bacteria 22213
32 Ga0157371_10016470 3300013102 Bacteria 5516
33 Ga0157369_10023638 3300013105 Bacteria 6846
34 Ga0157372_10000115 3300013307 Bacteria 84815
35 Ga0157372_10014363 3300013307 Bacteria 8468
36 Ga0157372_10036720 3300013307 Bacteria 5402
37 Ga0157375_10177025 3300013308 Unclassified 2283
38 Ga0163161_10095272 3300017792 Bacteria 2208
39 Ga0207426_1000019 3300025302 Bacteria 558579
40 Ga0207710_10001472 3300025900 Bacteria 11683
41 Ga0207647_10000112 3300025904 Bacteria 62895
42 Ga0207695_10000002 3300025913 Bacteria 2188391
43 Ga0207695_10000067 3300025913 Bacteria 330915
44 Ga0207695_10000361 3300025913 Bacteria 104230
45 Ga0207695_10073164 3300025913 Bacteria 3493
46 Ga0207681_10061712 3300025923 Bacteria 2578
47 Ga0207691_10039199 3300025940 Bacteria 4383
48 Ga0207667_10145390 3300025949 Bacteria 2441
49 Ga0207667_10277515 3300025949 Unclassified 1713
50 Ga0207712_10002874 3300025961 Bacteria 11008
51 Ga0207677_10063288 3300026023 Bacteria 2571
52 Ga0207703_10166366 3300026035 Bacteria 1936
53 Ga0207639_10000021 3300026041 Bacteria 233661
54 Ga0207678_10169060 3300026067 Bacteria 1867
55 Ga0207678_10219362 3300026067 Bacteria 1628
56 Ga0207702_10002552 3300026078 Bacteria 17142
57 Ga0207674_10171530 3300026116 Bacteria 2123
58 Ga0268266_10078167 3300028379 Bacteria 2879
59 Ga0265337_1009320 3300028556 Bacteria 3509
60 Ga0265319_1000075 3300028563 Bacteria 77601
61 Ga0265319_1010605 3300028563 Bacteria 3833
62 Ga0265318_10008581 3300028577 Bacteria 4539
63 Ga0265318_10010408 3300028577 Bacteria 4052
64 Ga0265323_10006516 3300028653 Unclassified 4908
65 Ga0265323_10006542 3300028653 Bacteria 4895
66 Ga0265323_10050214 3300028653 Unclassified 1483
67 Ga0265322_10013849 3300028654 Unclassified 2334
68 Ga0265322_10021010 3300028654 Unclassified 1870
69 Ga0307515_10000675 3300028794 Bacteria 78628
70 Ga0265338_10006491 3300028800 Bacteria 14880
71 Ga0265338_10006851 3300028800 Bacteria 14351
72 Ga0265338_10012171 3300028800 Bacteria 9827
73 Ga0265338_10017104 3300028800 Bacteria 7837
74 Ga0265338_10056073 3300028800 Bacteria 3499
75 Ga0265338_10056259 3300028800 Bacteria 3490
76 Ga0265338_10056677 3300028800 Bacteria 3472
77 Ga0265338_10175997 3300028800 Bacteria 1636
78 Ga0265328_10054718 3300031239 Bacteria 1465
79 Ga0265320_10002842 3300031240 Bacteria 11875
80 Ga0265320_10005092 3300031240 Bacteria 8496
81 Ga0265320_10008065 3300031240 Bacteria 6478
82 Ga0265320_10034444 3300031240 Bacteria 2575
83 Ga0265325_10017652 3300031241 Bacteria 3964
84 Ga0265325_10022685 3300031241 Bacteria 3435
85 Ga0265340_10030322 3300031247 Bacteria 2710
86 Ga0265339_10112272 3300031249 Bacteria 1409
87 Ga0265327_10001317 3300031251 Bacteria 32338
88 Ga0265316_10001700 3300031344 Bacteria 23353
89 Ga0265316_10007065 3300031344 Bacteria 10629
90 Ga0265313_10017868 3300031595 Bacteria 4006
91 Ga0265314_10001849 3300031711 Bacteria 22712
92 Ga0373954_0089270 3300035118 Bacteria 1479
93 Ga0373933_0195316 3300035724 Bacteria 1294
94 Ga0373937_0012474 3300036401 Bacteria 7477
95 Ga0451577_0012069 3300042876 Bacteria 8128
96 Ga0495592_0032862 3300046454 Unclassified 3914
97 Ga0495606_0000003 3300046507 Bacteria 449402
98 Ga0495628_0233008 3300046516 Bacteria 1379
99 Ga0495587_0024691 3300046536 Bacteria 3681
100 Ga0495613_0000724 3300046689 Bacteria 25847
101 Ga0495684_0066024 3300047471 Bacteria 2751
102 Ga0495686_0000937 3300047472 Bacteria 36184
103 Ga0495686_0106718 3300047472 Unclassified 1683
104 Ga0495602_0042602 3300048088 Bacteria 4134
105 Ga0496115_0066583 3300048918 Bacteria 2911
106 Ga0501046_0000642 3300049580 Bacteria 34219
107 Ga0501047_0280629 3300049581 Bacteria 1510
108 Ga0501044_0016743 3300049823 Bacteria 7869
109 nmdc:mga0k408_15019_c1 3300050493 Bacteria 4279
110 Ga0500635_0000621 3300053080 Bacteria 9270

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10169060 Ga0207678_101690603 293
2 3300046536 Ga0495587_0024691 Ga0495587_0024691_1289_2401 306
3 3300048088 Ga0495602_0042602 Ga0495602_0042602_2368_3480 306
4 3300028653 Ga0265323_10006516 Ga0265323_100065162 310
5 3300013307 Ga0157372_10036720 Ga0157372_100367203 311
6 3300010375 Ga0105239_10021112 Ga0105239_100211128 313
7 3300025913 Ga0207695_10000361 Ga0207695_1000036187 319
8 3300031241 Ga0265325_10022685 Ga0265325_100226852 321
9 3300009093 Ga0105240_10351851 Ga0105240_103518513 322
10 3300009551 Ga0105238_10096030 Ga0105238_100960302 322
11 3300013100 Ga0157373_10193246 Ga0157373_101932462 322
12 3300028563 Ga0265319_1000075 Ga0265319_100007551 322
13 3300028577 Ga0265318_10008581 Ga0265318_100085812 322
14 3300031240 Ga0265320_10005092 Ga0265320_100050926 322
15 3300031711 Ga0265314_10001849 Ga0265314_100018498 322
16 3300025949 Ga0207667_10145390 Ga0207667_101453902 323
17 3300047472 Ga0495686_0106718 Ga0495686_0106718_321_1292 323
18 3300028654 Ga0265322_10013849 Ga0265322_100138491 324
19 3300005354 Ga0070675_100027389 Ga0070675_1000273893 325
20 3300028800 Ga0265338_10056073 Ga0265338_100560733 325
21 3300031240 Ga0265320_10034444 Ga0265320_100344442 325
22 3300031241 Ga0265325_10017652 Ga0265325_100176523 325
23 3300048918 Ga0496115_0066583 Ga0496115_0066583_1735_2850 326
24 3300009093 Ga0105240_10000002 Ga0105240_10000002922 327
25 3300028800 Ga0265338_10006491 Ga0265338_100064914 328
26 3300031247 Ga0265340_10030322 Ga0265340_100303224 328
27 3300005539 Ga0068853_100349411 Ga0068853_1003494111 329
28 3300013100 Ga0157373_10007129 Ga0157373_100071297 329
29 3300006178 Ga0075367_10044853 Ga0075367_100448532 330
30 3300009551 Ga0105238_10190054 Ga0105238_101900542 330
31 3300028800 Ga0265338_10012171 Ga0265338_100121712 330
32 3300028800 Ga0265338_10056259 Ga0265338_100562593 330
33 3300005539 Ga0068853_100000046 Ga0068853_10000004644 331
34 3300026041 Ga0207639_10000021 Ga0207639_10000021135 331
35 3300028654 Ga0265322_10021010 Ga0265322_100210102 331
36 3300017792 Ga0163161_10095272 Ga0163161_100952721 332
37 3300025940 Ga0207691_10039199 Ga0207691_100391992 332
38 3300026067 Ga0207678_10219362 Ga0207678_102193622 332
39 3300031344 Ga0265316_10007065 Ga0265316_100070653 332
40 3300031240 Ga0265320_10008065 Ga0265320_100080655 334
41 3300025913 Ga0207695_10000002 Ga0207695_10000002926 337
42 3300025913 Ga0207695_10000067 Ga0207695_10000067100 337
43 3300028563 Ga0265319_1010605 Ga0265319_10106055 337
44 3300028577 Ga0265318_10010408 Ga0265318_100104081 337
45 3300028800 Ga0265338_10175997 Ga0265338_101759971 337
46 3300031239 Ga0265328_10054718 Ga0265328_100547182 337
47 3300031240 Ga0265320_10002842 Ga0265320_100028426 337
48 3300005563 Ga0068855_100022524 Ga0068855_1000225242 338
49 3300025900 Ga0207710_10001472 Ga0207710_100014729 339
50 3300028653 Ga0265323_10050214 Ga0265323_100502141 339
51 3300028794 Ga0307515_10000675 Ga0307515_1000067512 339
52 3300028800 Ga0265338_10006851 Ga0265338_1000685115 339
53 3300031344 Ga0265316_10001700 Ga0265316_1000170021 339
54 3300042876 Ga0451577_0012069 Ga0451577_0012069_324_1415 340
55 3300005834 Ga0068851_10135780 Ga0068851_101357801 341
56 3300006353 Ga0075370_10028385 Ga0075370_100283854 341
57 3300028653 Ga0265323_10006542 Ga0265323_100065422 341
58 3300005353 Ga0070669_100029389 Ga0070669_1000293894 342
59 3300005547 Ga0070693_100083239 Ga0070693_1000832392 342
60 3300005616 Ga0068852_100112862 Ga0068852_1001128623 342
61 3300005617 Ga0068859_100017762 Ga0068859_1000177626 342
62 3300005719 Ga0068861_100156201 Ga0068861_1001562013 342
63 3300006931 Ga0097620_100017762 Ga0097620_1000177626 342
64 3300009101 Ga0105247_10000817 Ga0105247_1000081722 342
65 3300009553 Ga0105249_10005856 Ga0105249_100058569 342
66 3300025923 Ga0207681_10061712 Ga0207681_100617122 342
67 3300025949 Ga0207667_10277515 Ga0207667_102775151 342
68 3300025961 Ga0207712_10002874 Ga0207712_100028745 342
69 3300026035 Ga0207703_10166366 Ga0207703_101663663 342
70 3300031251 Ga0265327_10001317 Ga0265327_100013175 342
71 3300035724 Ga0373933_0195316 Ga0373933_0195316_67_1158 342
72 3300053080 Ga0500635_0000621 Ga0500635_0000621_6135_7226 342
73 3300010375 Ga0105239_10000005 Ga0105239_10000005163 343
74 3300025913 Ga0207695_10073164 Ga0207695_100731642 343
75 3300046507 Ga0495606_0000003 Ga0495606_0000003_396884_397975 343
76 3300047472 Ga0495686_0000937 Ga0495686_0000937_16963_18066 343
77 3300049823 Ga0501044_0016743 Ga0501044_0016743_4843_5934 343
78 3300028556 Ga0265337_1009320 Ga0265337_10093203 344
79 3300028800 Ga0265338_10017104 Ga0265338_100171043 344
80 3300031249 Ga0265339_10112272 Ga0265339_101122721 344
81 3300031595 Ga0265313_10017868 Ga0265313_100178682 344
82 3300026023 Ga0207677_10063288 Ga0207677_100632882 345
83 3300028800 Ga0265338_10056677 Ga0265338_100566772 345
84 3300009098 Ga0105245_10314735 Ga0105245_103147351 346
85 3300013308 Ga0157375_10177025 Ga0157375_101770251 346
86 3300005614 Ga0068856_100000548 Ga0068856_10000054827 348
87 3300013100 Ga0157373_10007129 Ga0157373_100071293 348
88 3300013100 Ga0157373_10007129 Ga0157373_100071294 348
89 3300013102 Ga0157371_10001721 Ga0157371_1000172113 348
90 3300013102 Ga0157371_10001721 Ga0157371_1000172114 348
91 3300013307 Ga0157372_10014363 Ga0157372_1001436310 348
92 3300025302 Ga0207426_1000019 Ga0207426_1000019368 348
93 3300025904 Ga0207647_10000112 Ga0207647_1000011223 348
94 3300026078 Ga0207702_10002552 Ga0207702_1000255211 348
95 3300006195 Ga0075366_10024157 Ga0075366_100241573 349
96 3300050493 nmdc:mga0k408_15019_c1 nmdc:mga0k408_15019_c1_1794_2864 349
97 3300028379 Ga0268266_10078167 Ga0268266_100781673 351
98 3300013102 Ga0157371_10016470 Ga0157371_100164704 352
99 3300049580 Ga0501046_0000642 Ga0501046_0000642_21419_22510 352
100 3300049581 Ga0501047_0280629 Ga0501047_0280629_79_1170 352
101 3300005577 Ga0068857_100074410 Ga0068857_1000744103 353
102 3300005614 Ga0068856_100074637 Ga0068856_1000746372 353
103 3300035118 Ga0373954_0089270 Ga0373954_0089270_93_1232 353
104 3300036401 Ga0373937_0012474 Ga0373937_0012474_4999_6138 353
105 3300046689 Ga0495613_0000724 Ga0495613_0000724_976_2115 353
106 3300047471 Ga0495684_0066024 Ga0495684_0066024_1591_2730 353
107 3300046454 Ga0495592_0032862 Ga0495592_0032862_1499_2590 356
108 3300046516 Ga0495628_0233008 Ga0495628_0233008_53_1144 356
109 3300013105 Ga0157369_10023638 Ga0157369_100236382 359
110 3300013307 Ga0157372_10000115 Ga0157372_100001154 359
111 3300001990 JGI24737J22298_10000525 JGI24737J22298_1000052512 360
112 3300005577 Ga0068857_100173208 Ga0068857_1001732082 360
113 3300025904 Ga0207647_10000112 Ga0207647_1000011224 360
114 3300026116 Ga0207674_10171530 Ga0207674_101715302 360

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hh8-assembly1.cif.gz_A solution nmr structure of the ydfo protein from escherichia coli. northeast structural genomics target er251. 0.8848 215 239
3no2-assembly1.cif.gz_A crystal structure of a protein of unknown function (baccac_01654) from bacteroides caccae at 1.35 a resolution 0.8572 76 343
3no2-assembly1.cif.gz_A crystal structure of a protein of unknown function (baccac_01654) from bacteroides caccae at 1.35 a resolution 0.8283 76 343
8ey4-assembly1.cif.gz_A contact-dependent growth inhibition toxin-immunity protein complex from e. coli o32:h37 0.7732 295 336
7nyq-assembly1.cif.gz_A crystal structure of the mei-p26 nhl domain 0.7712 106 340
ID Description Score Start End Superfamily
af_D3ZVM4_770_855_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8854 204 266 2.40.10.500
af_B7YZK8_1231_1339_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8832 204 277 2.40.10.500
af_Q8BZW8_223_308_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8664 207 271 2.40.10.500
af_Q66H79_552_654_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8242 172 269 2.40.10.500
af_C0H4D3_525_642_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8022 106 230 2.40.128.630
ID Description Score Start End GO Terms
AF-A0A556MHI2-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9909 72 360
AF-A0A556MHI2-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9842 72 360
AF-A0A3B1DCM1-F1-model_v4 Uncharacterized protein 0.98 214 278
AF-A0A4V2MME3-F1-model_v4 PQQ-like domain-containing protein 0.9361 1 360
AF-A0A521ZJM0-F1-model_v4 Aryl sulfotransferase 0.929 86 360

Feature Viewer

pLDDT pTM Quality
90.17 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map